KEGG   Streptomyces griseus: SGR_5575Help
Entry
SGR_5575          CDS       T00691                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_5575 (tpiA)
   01230 Biosynthesis of amino acids
    SGR_5575 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_5575 (tpiA)
   00051 Fructose and mannose metabolism
    SGR_5575 (tpiA)
   00562 Inositol phosphate metabolism
    SGR_5575 (tpiA)
Enzymes [BR:sgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGR_5575 (tpiA)
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGR_5575 (tpiA)
  Exosomal proteins of bladder cancer cells
   SGR_5575 (tpiA)
  Exosomal proteins of melanoma cells
   SGR_5575 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6553031..6553807
Genome map
AA seq 258 aa AA seqDB search
MTTRTPLMAGNWKMNLNHLEAIAHVQKLSFALADKDYEDVEVAVLAPFTDLRSVQTLVDG
DKLKIKYGAQDISAHDSGAYTGEISGPMLAKLRCTYVAVGHSERRQYHGENDEICNAKVK
AAFKHGLTPILCVGEGLDVRKAGDQVSYTLAQLDGALKDVPAEQAETIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQELADAVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctctcgttcgccctggccgacaaggactacgaggacgtc
gaggtcgccgtcctggcgcccttcaccgacctgcgctccgtgcagaccctggtggacggc
gacaagctgaagatcaagtacggcgcccaggacatctcggcgcacgactccggcgcgtac
accggtgagatctccggccccatgctcgccaagctgcgctgcacgtacgtggccgtcggc
cacagcgagcgccgccagtaccacggcgagaacgacgagatctgcaacgccaaggtgaag
gccgccttcaagcacggcctgacgccgatcctctgcgtcggcgagggcctggacgtccgc
aaggccggtgaccaggtctcctacaccctcgcgcagctcgacggcgccctgaaggacgtc
ccggccgagcaggccgagaccatcgtcatcgcctacgagccggtctgggccatcgggacc
ggcgaggtcgccactcccgaggacgcccaggaggtctgcggcgcgatccgcggccggctg
gccgagctgtactcccaggagctggccgacgccgtccgtatccagtacggcggctcggtg
aagtccggcaacgtcgcggccatcatggcgcagcccgacgtggacggcgccctcatcggc
ggcgccgcactggacgccgacgagttcgtcaagatcgtccgcttccgcgaccagtga

DBGET integrated database retrieval system