KEGG   Streptomyces griseus: SGR_5575Help
Entry
SGR_5575          CDS       T00691                                 

Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00051  Fructose and mannose metabolism
sgr00562  Inositol phosphate metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
sgr01230  Biosynthesis of amino acids
Module
sgr_M00002  Glycolysis, core module involving three-carbon compounds
sgr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_5575
   00051 Fructose and mannose metabolism
    SGR_5575
   00562 Inositol phosphate metabolism
    SGR_5575
Enzymes [BR:sgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SGR_5575
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SGR_5575
  Exosomal proteins of bladder cancer cells
   SGR_5575
  Exosomal proteins of melanoma cells
   SGR_5575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAG22404
Kitasato: SGR5575
UniProt: B1W0Z4
Position
6553031..6553807
Genome map
AA seq 258 aa AA seqDB search
MTTRTPLMAGNWKMNLNHLEAIAHVQKLSFALADKDYEDVEVAVLAPFTDLRSVQTLVDG
DKLKIKYGAQDISAHDSGAYTGEISGPMLAKLRCTYVAVGHSERRQYHGENDEICNAKVK
AAFKHGLTPILCVGEGLDVRKAGDQVSYTLAQLDGALKDVPAEQAETIVIAYEPVWAIGT
GEVATPEDAQEVCGAIRGRLAELYSQELADAVRIQYGGSVKSGNVAAIMAQPDVDGALIG
GAALDADEFVKIVRFRDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcaccccgctgatggcgggcaactggaagatgaacctcaaccacctcgag
gccatcgcccacgtccagaagctctcgttcgccctggccgacaaggactacgaggacgtc
gaggtcgccgtcctggcgcccttcaccgacctgcgctccgtgcagaccctggtggacggc
gacaagctgaagatcaagtacggcgcccaggacatctcggcgcacgactccggcgcgtac
accggtgagatctccggccccatgctcgccaagctgcgctgcacgtacgtggccgtcggc
cacagcgagcgccgccagtaccacggcgagaacgacgagatctgcaacgccaaggtgaag
gccgccttcaagcacggcctgacgccgatcctctgcgtcggcgagggcctggacgtccgc
aaggccggtgaccaggtctcctacaccctcgcgcagctcgacggcgccctgaaggacgtc
ccggccgagcaggccgagaccatcgtcatcgcctacgagccggtctgggccatcgggacc
ggcgaggtcgccactcccgaggacgcccaggaggtctgcggcgcgatccgcggccggctg
gccgagctgtactcccaggagctggccgacgccgtccgtatccagtacggcggctcggtg
aagtccggcaacgtcgcggccatcatggcgcagcccgacgtggacggcgccctcatcggc
ggcgccgcactggacgccgacgagttcgtcaagatcgtccgcttccgcgaccagtga

DBGET integrated database retrieval system