KEGG   Streptomyces griseus: SGR_5643Help
Entry
SGR_5643          CDS       T00691                                 

Definition
(GenBank) putative magnesium-chelatase subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
sgr  Streptomyces griseus
Pathway
sgr00860  Porphyrin and chlorophyll metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SGR_5643
Enzymes [BR:sgr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SGR_5643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 VWA Mg_chelatase AAA_5 AAA_16 MCM Sigma54_activat VWA_3 HRDC
Motif
Other DBs
NCBI-ProteinID: BAG22472
Kitasato: SGR5643
UniProt: B1W1S5
Position
complement(6619462..6621501)
Genome map
AA seq 679 aa AA seqDB search
MSTPYPFTAIVGQDDLRLGLLLNAVSPAVGGVLVRGEKGTAKSTAVRALAALMPEVSVVP
GCRFSCDPGSPDPACPDGPHAEAAGVSRAARTVELPVGASEDRLVGALDIERALSEGVKA
FEPGLLADAHRGILYVDEVNLLHDHLVDLLLDAAAMGASYVEREGVSVRHAARFLLVGTM
NPEEGELRPQLLDRFGLTVEVAASRDTDERVEVVRRRLAYDDDPEGFAARWAAEESALRE
RIAAARALLPRVVLGDGVLRQIAATCAAFEVDGMRADIVMARTATALAAWAGREEVTADD
VRQAALLALPHRRRRNPFDAPGLDEDKLDRTLDEAGDQGQDDDNDDDPGPGPDGDGGGGG
GVPPQADGEDRTPPRADGGSDDAPSGAPEGGPDAPGRSTGAEQRPVASAEPFRTKTLSVP
GLGEGAAGRRSRARTEHGRTTGARRPQGALTKLHLAATVQAAAPHQRARGRSGRGLVVRR
DDLRQATREGREGNLVLFVVDASGSMAARQRMSAVKGAVLSLLLDAYQRRDKVGLVTFRG
REAEVALPPTSSVDAAASRLESLPTGGRTPLAAGLLKAHDVLRVERLRDPSRRPLLVVVT
DGRATGGPEPVALAGRAGRLHRSEGTASVVVDCESGYVRLGLAGELARELGGAAVTLDEL
RADSIAGLVKDVTAAGRAA
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacgccgtatcccttcaccgcgatcgtcgggcaggacgacctgcggctcggactg
ttgctgaacgcggtcagtccggccgtcggcggggtgctcgtgcggggcgagaaggggacc
gccaagtccaccgccgtgcgggccctggccgcgctgatgcccgaggtctccgtcgtgccc
gggtgccggttctcctgcgatcccggctcccccgatccggcgtgtcccgacgggccgcac
gcggaggccgccggtgtgtcgcgggccgcgcggaccgtggagctgcccgtcggcgcgtcg
gaggaccggctcgtgggggcgctggacatcgagcgggcgctctcggagggcgtgaaggcg
ttcgagccgggcctgctggccgacgcgcaccgggggatcctgtacgtcgacgaggtcaac
ctcctccacgaccacctggtggacctgctgctggacgcggcggccatgggcgcctcgtac
gtcgagcgcgagggcgtttccgtacggcatgcggcgcggttcctgctggtcgggacgatg
aacccggaggagggcgagctgcggccgcagttgctggaccggttcgggctgaccgtcgag
gtggccgcgtcccgggacaccgacgagcgggtcgaggtcgtgcggcgcaggctcgcgtac
gacgacgaccccgaggggttcgccgcgcgctgggcggcggaggagagcgccctgcgcgag
cggatcgccgccgcgcgcgccctgctgccccgcgtcgtgctcggcgacggcgtgttgcgg
cagatcgccgcgacctgcgccgcgttcgaggtggacgggatgcgggccgacatcgtgatg
gcccggaccgccaccgcgctcgccgcctgggcgggccgcgaggaggtcaccgccgacgac
gtgcggcaggcggccctgctggccctcccccaccggcgtcgccgcaaccccttcgacgcg
cccggtctggacgaggacaagctcgaccggaccctggacgaggccggggaccaggggcag
gacgacgacaacgacgacgaccccggccccggcccggacggcgacggcggagggggcggc
ggtgtgccgccgcaggccgacggggaggaccgtacgccgccccgggcggacggcggctcg
gacgacgcgccgtccggggcccccgagggcggccccgacgcgcccggccggtccaccggg
gccgagcagcggccggtggcgtccgccgagccgttccggacgaagacgctcagcgtgccg
gggctcggcgagggtgctgcgggtcggcgctcccgggcgcgtaccgagcatgggcgtacg
accggcgcgcgccggccgcagggggcgctgaccaagctgcacctggccgccaccgtccag
gccgccgccccgcaccagcgggcgcgcgggcgttccgggcgggggctcgtggtgcgccgg
gacgatctgcggcaggcgacccgcgaggggcgcgagggcaacctcgtgctgttcgtcgtg
gacgcgtcgggctcgatggcggcgcggcagcggatgagcgcggtcaagggggccgtgctg
tcgctgctgctggacgcctaccagcggcgggacaaggtcggcctggtcaccttccggggc
agggaggcggaggtggcgctgccgccgacctcgtccgtggacgccgccgcctcccgtctg
gagtcgctgccgaccggtggccgtacgcctctcgccgccgggctgctcaaggcccacgac
gtactgcgggtggagcggctgcgcgatccctcgcgtcggccgttgctcgtcgtcgtcacg
gacggcagggcgaccggcgggccggagccggtggcgctcgcgggccgggccgggcggctg
caccgctcggaggggacggcgtccgtcgtcgtggactgcgagtcggggtacgtacgcctc
ggtctcgccggggagttggcccgggaactgggaggcgccgccgtcacgctcgacgagctg
cgggccgactccatcgccgggctcgtcaaggacgtcaccgcagccgggagggccgcttaa

DBGET integrated database retrieval system