KEGG   Streptomyces griseus: SGR_5844Help
Entry
SGR_5844          CDS       T00691                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sgr  Streptomyces griseus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sgr00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6841489..6843033)
Genome map
AA seq 514 aa AA seqDB search
MTDAHTTGTHGSGPFIAAIDQGTTSSRCIVFDKDGRIVSVDQKEHEQIFPKPGWVEHDAT
EIWENVQEVVAGAIVKAGITSADVKAIGITNQRETTLLWDKNTGEPVHNALVWQDTRTDA
LCKELGRNVGQDRFRRETGLPLASYFAGPKVRWLLDNVEGLRERAERGDILFGTMDSWVI
WNLTGGTDGGVHVTDVTNASRTLLMNLHTMAWDEKILSSIGIPAAVLPEIRSSAEVYGNA
KGGILDGVPVASALGDQQAALFGQTCFSEGEAKSTYGTGTFMLMNTGGTPVNSYNGLLTT
VGYQIGDQPPVYALEGSIAVTGSLVQWMRDQMGLIKSAAEIETLASSVEDNGGAYFVPAF
SGLFAPYWRPDARGVITGLTRYVTKAHIARAVLEATAWQTREISDAMTKDSGVELTALKV
DGGMTSNNLLMQTLADFLDAPVVRPMVAETTCLGAAYAAGLAVGFWPDTDALRANWRRAA
EWTPRMDADTRAREYKSWLKAVERTMGWIEDEES
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacgcacacaccaccggcacccacggcagcggaccgttcatcgccgccatcgac
cagggcaccacctccagccgctgcatcgtcttcgacaaggacggccggatcgtctccgtc
gaccagaaggagcacgagcagatcttccccaagccgggctgggtcgagcacgacgcgacc
gagatctgggagaacgtccaggaggtcgtcgccggggccatcgtcaaggccggcatcacc
tccgccgacgtcaaggcgatcggcatcaccaaccagcgcgagaccacgctgctctgggac
aagaacaccggcgagccggtgcacaacgcgctggtctggcaggacacccgcaccgacgcg
ctctgcaaggagctcggccgcaacgtgggccaggaccggttccgccgcgagaccggactg
ccgctcgcctcgtacttcgccgggcccaaggtccgctggctgctcgacaacgtcgaggga
ctgcgcgagcgcgccgagcgcggcgacatcctcttcggcaccatggactcctgggtcatc
tggaacctgaccggcggcaccgacggcggcgtccacgtcaccgacgtcaccaacgcctcg
cgcaccctcctgatgaacctgcacacgatggcctgggacgagaagatcctgtcctccatc
ggcatcccggccgcggtgctccccgagatccgctcctccgccgaggtctacggcaacgcc
aagggcggcatcctcgacggcgtcccggtcgcctccgcgctcggcgaccagcaggcggcc
ctgttcggccagacctgcttctccgagggcgaggccaagtccacgtacggcaccggcacc
ttcatgctgatgaacaccggtggcaccccggtgaactcgtacaacgggctgctcaccacc
gtcggctaccagatcggcgaccagcccccggtgtacgcgctggagggctccatcgcggtc
accggctcgctggtgcagtggatgcgcgaccagatgggcctgatcaagtcggccgccgag
atcgagaccctggcctcctcggtcgaggacaacggcggcgcgtacttcgtgcccgccttc
tccggcctcttcgccccctactggcgtcccgacgcccgcggggtgatcaccggtctcacc
cgttacgtcaccaaggcgcacatcgcccgtgccgtcctggaggccaccgcctggcagacc
cgcgagatcagcgacgccatgacgaaggactccggcgtcgagctgaccgcgctcaaggtc
gacggcgggatgacctccaacaacctgctgatgcagacgctcgccgacttcctggacgcg
cccgtggtgcgccccatggtcgccgagaccacctgcctcggcgccgcctacgccgccggt
ctggccgtcggcttctggccggacaccgacgcgctgcgcgccaactggcgccgggccgcc
gagtggacaccccgcatggacgcggacacccgtgcccgcgagtacaagagctggctcaag
gccgtcgaacggaccatgggctggatcgaggacgaagaaagctga

DBGET integrated database retrieval system