KEGG   Streptomyces griseus: SGR_6016Help
Entry
SGR_6016          CDS       T00691                                 

Definition
(GenBank) putative Holliday junction DNA helicase subunit B
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sgr  Streptomyces griseus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SGR_6016
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SGR_6016
DNA repair and recombination proteins [BR:sgr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SGR_6016
    RecFOR pathway proteins
     SGR_6016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
7032922..7033548
Genome map
AA seq 208 aa AA seqDB search
MIAFVSGPVAALAPTTAVIEVGGIGMAVQCTPHTLADLRVGREARLATSLVVREDSLTLY
GFANDDERQVFELLQTASGVGPRLAQAMLATHSPDALRLAVSTGDEKALTAVSGIGKKGA
QKLLLELKDRLGEPVGAHIGQQGIGTPVTSGWRDQLQAALIGLGYASREADEAVNAVAPQ
AEAAVAEGTAPPVPQLLRAALQTLNRAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcgctttcgtctccggcccggtggccgccctcgccccgaccaccgccgtcatcgag
gtcggcggcatcggcatggcggtccagtgcaccccgcacaccctcgccgacctgcgcgtc
ggcagggaggcccggctcgccacctcgctggtcgtccgcgaggactccctcaccctgtac
ggcttcgcgaacgacgacgagcggcaggtgttcgagctgctccagaccgccagcggcgtc
ggaccgcgcctcgcccaggccatgctcgccacccacagccccgacgccctgcgcctcgcg
gtctccaccggcgacgagaaggcgctgaccgccgtctccggcatcgggaagaagggcgcc
cagaagctgctgctggagctcaaggaccggctcggcgaaccggtcggcgcgcacatcggc
cagcagggcatcggcacccccgtcacctccggctggcgcgaccagctccaggccgccctg
atcggcctcggctacgcgagccgcgaggccgacgaggccgtcaacgccgtcgccccgcag
gccgaggccgccgtcgccgagggcaccgcaccccccgtgccccaactgctgcgggccgcc
ctgcagactctcaaccgcgcacgctga

DBGET integrated database retrieval system