KEGG   Streptomyces griseus: SGR_621Help
Entry
SGR_621           CDS       T00691                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K21190  
dehydrogenase
Organism
sgr  Streptomyces griseus
Pathway
Biosynthesis of enediyne antibiotics
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    SGR_621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(726529..727545)
Genome map
AA seq 338 aa AA seqDB search
MKAAVIPAVNARWEIQEVPTPRPGPGEVLVKVHACGLCHNDLWTAQGVFPFPSCDPAITG
HEAAGEVVELGPGTTTREVGDRVGTTWVQATCGRCAYCRRNLPLTGQSAMSCAAPVMTGL
TVQGGHAEYLCVAAASTVLLPDGLDYATAAPVLCAGYTAWSALRVSEPRPHERIAVLGIG
GLGHLAVQYSRACGYETVAITRSAEKHEVSTRLGADLVVRDGEELREAGGADVVLVTGTS
YEAATDALQGLRTGGRIVLATIDPAGSFTIDPATPFWARGQRVLGATHHGLRYLTEALDL
VAEGAVTPMTEVFPMDAVADAVDKVEKGEVRFRAVVTY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtcatccccgcggtcaacgcccgctgggagatccaggaggttccgacg
ccccggccgggccccggcgaggtgctcgtcaaggtgcacgcctgcggactctgccacaac
gacctctggaccgcccagggcgtcttccccttcccgtcgtgcgatccggcgatcacgggg
cacgaggcggcgggcgaggtcgtcgaactggggccgggcaccaccacccgcgaggtgggc
gaccgcgtcggcaccacctgggtccaggccacctgcggccggtgcgcctactgccggcgc
aaccttccgctgaccggccagtccgccatgtcctgcgcggcgccggtgatgaccggcctg
accgtgcagggcggccacgccgagtacctctgcgtggccgccgcgagcaccgtgctcctc
cccgacgggttggactacgcgacggccgcgcccgtcctctgcgcgggctacaccgcctgg
agcgccctgcgggtgagcgaaccgcggccgcacgagcggatcgccgtcctcggcatcgga
ggcctcgggcaccttgccgtgcagtactcccgggcctgcgggtacgagaccgtcgccatc
acccgctccgccgagaagcacgaggtctccacgagactcggggccgacctcgtggtccgc
gacggggaggagctgcgcgaggccggcggcgccgacgtcgtcctggtcaccggcacgtcc
tacgaggcggcgacggacgccctccagggactgcggaccggcgggcggatcgtgctcgcc
accatcgacccggcgggttcgttcaccatcgatcccgccaccccgttctgggcccggggc
cagcgtgtgctgggcgccacccaccacgggctgcggtacctgaccgaggcgctcgacctg
gtcgcggagggcgcggtgaccccgatgacggaggtctttccgatggacgcggtcgcggac
gccgtcgacaaggtggagaagggcgaggtccgcttccgcgccgtcgtgacctactga

DBGET integrated database retrieval system