KEGG   Streptomyces griseus: SGR_6306Help
Entry
SGR_6306          CDS       T00691                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgr  Streptomyces griseus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGR_6306
   01230 Biosynthesis of amino acids
    SGR_6306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_6306
   00030 Pentose phosphate pathway
    SGR_6306
   00051 Fructose and mannose metabolism
    SGR_6306
   00052 Galactose metabolism
    SGR_6306
  Energy metabolism
   00680 Methane metabolism
    SGR_6306
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SGR_6306
Enzymes [BR:sgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGR_6306
Protein phosphatases and associated proteins [BR:sgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGR_6306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(7481657..7482682)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFHDGWKGLLECDYRKLDLDAVGGI
LARGGTILGSSRVQPAHLRDGVERARGHVADLGLDAIIPIGGEGTLKAANLLSEAGLPIV
GVPKTIDNDIASTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIDELTELVGKRFSAGKKFAIVVVAEGAKPREGSMQFEQGVKDI
YGHERFAGVATQLSGELEQRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GEFGMLTALRGTDIVMVPLGEAVETLKTVPAERYAEAECVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattggcgtactcacctccggcggcgactgccccggcctcaacgccgtcatccgt
tccgtcgtgcaccgcgcggtggtggaccacggcgacgaggtcatcggcttccacgacggc
tggaagggcctgctggagtgcgactaccgcaagctcgaccttgacgcggtgggcggcatc
ctggcccgcggcggcacgatcctcggttcctcccgggtccagcccgcgcatctgcgcgac
ggcgtggagcgcgcccgcggccatgtcgcggacctcggcctggacgccatcatcccgata
ggcggcgagggcaccctcaaggcggcgaatctcctctccgaggccggtctcccgatcgtc
ggcgtccccaagaccatcgacaacgacatcgcctccaccgacgtcaccttcggcttcgac
accgccgtcggcgtcgccaccgaggccctggaccggttgaagaccaccgccgagtcgcac
cagcgggtgctgatcgtcgaggtcatgggacggcacaccggctggatcgccctgcactcc
ggcatggccgccggagcccacgccatcgtggtgcccgagcgccccttcgacatcgacgag
ctgaccgagctggtcggcaagcgcttctcggcgggcaagaagttcgccatcgtggtggtc
gccgagggcgccaagccgcgcgagggctccatgcagttcgagcagggcgtcaaggacatc
tacggccacgagcggttcgccggggtggccacgcagctctccggggagctggagcagcgg
ctcggcaaggaggcccgcccggtcatcctcggccacgtccagcgcggcggcacgcccacc
gcgtacgaccgggtcctggcgacccggttcggctggcacgcggtggaggcggcgcaccgg
ggcgagttcgggatgctgaccgcgctgcgcggcaccgacatcgtgatggtcccgctgggc
gaggccgtcgagacgctgaagacggtccccgccgagcggtacgccgaggcggagtgcgtg
ctctag

DBGET integrated database retrieval system