KEGG   Streptomyces griseus: SGR_6312Help
Entry
SGR_6312          CDS       T00691                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sgr  Streptomyces griseus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SGR_6312
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SGR_6312
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SGR_6312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(7487665..7488153)
Genome map
AA seq 162 aa AA seqDB search
MTLHDIPLRTLAGEPTTLGAYSGRAVLLVNVASKCGLTPQYEGLERLQQNYGDRGLTVLG
VPCNQFAGQEPGSAEEIQTFCSTTYGVTFPLLEKIDVNGADRHPLYAELTKLADADGEAG
DVQWNFEKFLISPAGEPVARLRPRAEPEATEVVAAIEAQLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcacgacattccgctgcgcaccctcgcgggcgagccgaccacgctgggcgcg
tacagcggccgggccgtcctcttggtgaacgtggcctccaagtgcgggctcaccccgcag
tacgagggcctggagcggttgcagcagaactacggggaccggggcctgaccgtgctcggc
gtcccgtgcaaccagttcgccggccaggagccgggcagcgcggaggagatccagaccttc
tgctcgacgacgtacggggtcaccttcccgctgctggagaagatcgacgtgaacggcgcg
gaccggcacccgctgtacgcggagctgacgaagctggcggacgcggacggggaggccggg
gacgtccagtggaacttcgagaagttcctcatctcgccggccggtgagcccgtcgcccgg
ctccggccgcgcgccgagcccgaggccacggaggtcgtggcggcgatcgaggcgcagttg
ccccgctga

DBGET integrated database retrieval system