KEGG   Streptomyces griseus: SGR_6763Help
Entry
SGR_6763          CDS       T00691                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sgr  Streptomyces griseus
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sgr00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
8084439..8086826
Genome map
AA seq 795 aa AA seqDB search
MSDTRTPSDPPVLSDDELSALDAHWRAANYLAVGQIYLMANPLLTRPLVPEDIKPRLLGH
WGTSPGLNLVHTHLNRVIKDRDLNALCVWGPGHGGPAVLANSWLEGSYSETYPDVGRDAE
GMGLLFKQFSFPGGVPSHVAPETPGSIHEGGELGYSLAHAYGAAFDHPDLVVACVIGDGE
AETGPLAASWHGNKFLDPVHDGAVLPILHLNGYKIANPTVLARIPEDELDRLLRGYGHDP
LFVTGDDPATVHRALAAALDTALDRIGAYQRAAREDSATERPDWPMIVLRTPKGWTGPEE
VDGVPVENTWRSHQVPLPGVRENPEHLRQLEAWLRSYRPAELFDADGRPTERVLARVPEG
AARLGSTPYANGGLLLRDLPLPDPADHAVRVDRPGTTLHEPTKVLGGLLESVMAATADRR
DFRVVGPDETASNRLDALYRATGKAWQAGTLPTDEHLAHDGRVMEVLSEHLCQGWLEGYL
LTGRHGLFSSYEAFAHIVDSMVNQHIKWLRTSRRLPWRRPIASLNYLLTSHVWRQDHNGF
SHQDPGFVDHILNKSPEVVRVYLPPDSNTLLSVADHVLRSRDYVNVIVAGKQPTFDWLTP
REARGHCARGAGAWEWAGTEDGSREPDVVLACAGDVPTQETLAAADLIRRHLPELALRVV
NVVDIARMMPDTEHPHGMPDAEYDALFTRDRPVIFAYHGYPWLIHRLAYRRHGHAHLHVR
GYKEEGTTTTPFDMVVRNDLDRYRLVMDVIDRVPGLGVRAVAVRQEMADARTRHHAWIRE
HGTDLPEVVDWTWGG
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacacccgcaccccctccgatccccccgtgctctccgacgacgaactctccgcg
ctcgacgcgcactggcgcgcggccaactacctcgcggtcggccagatctacctcatggcc
aaccccctgctgacccggccgctcgtccccgaggacatcaagccgcggctgctcggccac
tggggcacctcgccggggctcaatctcgtccacacccacctcaaccgggtgatcaaggac
cgcgacctgaacgccctgtgcgtgtgggggcccggccacgggggaccggccgtcctcgcc
aattcctggctggagggcagctactccgagacctacccggacgtcggccgggacgccgag
ggcatgggactgctgttcaaacagttctcgttccccggcggcgtgcccagccacgtcgcc
cccgagacgcccggctccatccacgagggcggcgaactcggctactccctggcccacgcc
tacggagccgccttcgaccacccggacctcgtggtggcctgcgtgatcggcgacggcgag
gccgagacggggccgctcgccgcctcctggcacggaaacaaattcctcgacccggtccac
gacggggccgtcctgcccatcctccacctcaacggctacaagatcgccaacccgacggtc
ctcgcccgcatccccgaggacgagctcgaccggctgctgcgcggctacggccacgacccc
ctgttcgtcacgggcgacgacccggccaccgtccaccgggcactcgccgccgccctggac
accgccctggaccggatcggcgcctaccagcgggccgcccgcgaggacagcgcgaccgag
cgccccgactggcccatgatcgtgctgcgcacccccaagggctggaccggacccgaggag
gtcgacggagtccccgtcgagaacacctggcgctcccaccaggtcccgctccccggcgtc
cgcgagaacccggaacacctgcggcaactggaggcctggctgcgctcctaccggcccgcc
gaactcttcgacgccgacggccgccccaccgaacgggtcctcgcccgcgtccccgaggga
gcggcccgcctcggctccaccccgtacgccaacggcgggctgctcctgcgcgacctcccg
ctgcccgacccggcggaccacgccgtacgggtcgaccggcccggcaccaccctccacgaa
ccgaccaaggtgctcggcggcctcctggagagcgtcatggccgccaccgcggaccgcagg
gacttccgcgtcgtcggccccgacgagaccgcctccaaccggctggacgccctctaccgg
gccaccggcaaggcctggcaggccggcaccctgcccaccgacgaacacctcgcccacgac
ggccgggtgatggaggtgctctccgaacacctctgccagggctggctggaggggtacctc
ctcaccggacggcacggactcttctccagctacgaggcgttcgcccacatcgtcgactcc
atggtcaaccagcacatcaaatggctgcgcacctcgcggcggctgccctggcggcggccc
atcgcctcgctcaactacctgctcacctcacatgtctggcgccaggaccacaacggcttc
tcgcaccaggaccccggcttcgtcgaccacatcctcaacaagagccccgaggtcgtccgc
gtctacctcccaccggactccaacaccctgctctccgtcgccgaccacgtgctgcgcagc
cgggactacgtcaacgtgatcgtggccggcaaacagccgaccttcgactggctcacaccg
cgggaggcccgaggccactgcgcgcgcggggccggggcctgggagtgggccgggaccgag
gacgggagccgggaaccggacgtggtcctcgcctgcgccggggacgtacccacgcaggag
accctggcagcggcggacctgatccggcgccacctcccggagctcgccctgcgtgtggtc
aacgtggtcgacatcgcccgcatgatgcccgacaccgagcatccgcacggcatgccggac
gccgagtacgacgccctgttcacccgcgacaggccggtgatcttcgcctaccacggctac
ccgtggctgatccaccggctcgcctaccgccgccacggccacgcccacctccatgtgcgc
ggctacaaggaggagggcaccacgaccacgccgttcgacatggtcgtccgcaacgacctc
gaccgctaccggctggtcatggacgtcatcgaccgggtgcccggtctcggcgtccgcgcc
gtcgccgtacgccaggagatggcggacgcccgcacccgccaccacgcgtggatccgcgaa
cacggcacggacctgccggaggtcgtcgactggacatggggcggctga

DBGET integrated database retrieval system