KEGG   Streptomyces griseus: SGR_6784Help
Entry
SGR_6784          CDS       T00691                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sgr  Streptomyces griseus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sgr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
8131112..8133148
Genome map
AA seq 678 aa AA seqDB search
MCGIAGFVSPSLDAGATPEVIASMLSLIRHRGPDEAGYYLDDGVAMGTVRLSVIDLATGA
QPMADPSDRYWICFNGELYNHVELRRELRGLGRHFRTRSDTEVVLQAWAQWGAGALPRFN
GAFAFAIRDAVSGDLFLARDRYGKRPVFYSDRGSGTGPDGDFLFASEMKAFRAFPGFRFE
LDPGELASAFAVWTPLPDRTPFRHIRQLPMGSFLTVRGGRVDLTTYAELEIDADPFTGSA
REAVAFVRDTLRESVAMRLRSDVEVGVYLSGGLDSSIVTALATELSPHAVRTFSVEFDEA
AFDESGSQHVVASHLGSLHSSIAVRGADIAANFPSAVYHAEVPAFRTAFVPMYLLSRHVR
DAGIKVILSGEGADEAFLGYSLFRETLLRAAWHDLSDDERMAGIGRLHPELSHFGPANRA
RLKGLFEQFAVERLPGLFSHELRYQNGRFAARLLKERGDPFADLLALTASTPGYAALSPV
QKAQWLEFKTLLPGYLLSTQGERMSLAHGIENRCPFLDPAVVRAAASVNLRFDDGSEEKA
ILKEAFRGELPESSLARRKQPYRAPGAAVFKEHRPDYMELLLSETELRKIDGLDPVFARK
LVAKIMATPSEGISTKEDQAFIYLLSTAVLHQQFAGGRDRGRAGHPEAELKADTIVDLRG
SRGPRPAAHALHGAGGPR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgcaggcttcgtctcgccctcgctcgacgccggggccacgcccgaggtc
atcgcctcgatgctgtcgctcatccgccaccgcggcccggacgaggcgggctactacctg
gacgacggggtggccatgggcacggtcaggctgtcggtcatcgacctcgccacgggcgcc
cagcccatggcggacccgtccgaccgctactggatctgcttcaacggcgagttgtacaac
cacgtcgaactccgccgggagctgcgagggctcggccggcacttccgcacccgctcggac
accgaagtggtcctccaggcgtgggcccagtggggagcgggcgctctgccccgtttcaac
ggcgcgttcgccttcgccatccgggacgcggtgtccggggacctcttcctggcccgggac
aggtacggcaagcgcccggtcttctacagcgaccgggggagcggcacgggcccggacggg
gatttcctcttcgcctcggagatgaaggcgttccgggcattccccggattccgcttcgaa
ctggaccccggagaactcgcctccgctttcgcggtgtggaccccgttgcccgaccggacc
cccttccggcacatccgccaactgcccatggggagcttcctgaccgtgcgcggtggccgc
gtggatctgaccacgtacgccgaactcgaaatcgacgccgacccgttcaccggttccgcc
cgggaagcggtcgcattcgtccgcgacaccctccgggaaagcgtcgcgatgcggctgcgg
agcgacgtcgaggtcggggtctacctgagcggaggcctcgactcgtccatcgtcaccgca
ctggcgaccgaactctccccgcacgcggtccgcacgttctcggtcgagttcgacgaggcg
gccttcgacgagtcgggcagccagcacgtcgtcgcctcgcacctcgggtcgctccactcg
tccatcgccgtgcgcggcgcggacatcgccgcgaacttcccgtccgccgtttaccacgcc
gaagtcccggcgttccggacggcgttcgtgcccatgtacctgctctcccgtcatgtgcgc
gacgccggcatcaaggtgatcctcagcggcgagggcgccgacgaggccttcctcggctac
tccctcttccgggagaccctgctgcgtgccgcgtggcacgacctctccgacgacgaacgc
atggccgggatcgggcgccttcacccggagctgagccacttcggtcccgcgaaccgggcc
cggctgaagggcctgttcgagcagttcgccgtggaacggctccccggcctcttctcgcac
gaactccgctaccagaacggccgtttcgccgcacgtctgctgaaggagcggggcgatccg
ttcgcggacctcctggcgctgacggcgtcgacacccggatacgccgccctgagccccgtg
cagaaggcccagtggctcgagttcaagaccctgctgcccggctacctgctctccacccag
ggggagcgcatgagcctcgcccacggcatcgagaaccgctgccccttcctcgatcccgcg
gtggtccgtgcggcggcctcggtcaatctgcggttcgacgacggctccgaggagaaggcc
atcctcaaggaggccttccggggcgagctgccggaatcgagcctcgcccggcgcaagcag
ccctaccgcgcccccggcgcggccgtcttcaaggagcaccggcccgactacatggagctg
ctgctctcggagacggagctgcggaagatcgacggcctcgacccggtgttcgcgaggaag
ctcgtggcgaagatcatggcgacacccagcgaggggatcagcacgaaggaggaccaggcc
tttatctacctgctgtcgacggccgtcctgcaccagcagttcgcgggcggccgggaccgg
gggagggccggccacccggaagcggagcttaaggcggacacgatcgtcgatctccgtggc
tcccggggaccgcggccggccgcgcacgccctccacggggcgggaggcccccgatga

DBGET integrated database retrieval system