KEGG   Streptomyces griseus: SGR_683Help
Entry
SGR_683           CDS       T00691                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sgr  Streptomyces griseus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGR_683
   00330 Arginine and proline metabolism
    SGR_683
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SGR_683
Enzymes [BR:sgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SGR_683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
807215..808498
Genome map
AA seq 427 aa AA seqDB search
MRPIIPDYLAEVLEQVEPDASGAPAAYIPELAEADPERLGAAFATVDGRVHGAGDIDVPF
TIQSISKPFAYALALADRGFGTVLAKVGVEPSGEAFNEISLESGTGRPLNPMINAGAITV
HSLVAEAGSGPAERVRRVLDGLSAFAGRRLETDEKVCASELEHAHRNLAIAHMLRGHDIL
TEDVRAVVDGYTRQCSVLVTTRDLAVMAATLANRGVNPLSGEQVVPEGVVRQVLSVMFSC
GMYDAAGDWATQVGIPAKSGVAGGLIGALPGRIGIATFSPRLDSHGNSVRGVSLFERFSS
DMGLHVMEVPSAGRAAVRSSHVLGGGPDALRVLELQGGIGFAGAERVVREVLDTDPREAR
VAIDLTRVHAIDDVARRMVLEIARRLTLDGREVFLVDPEAVIPDPDPGDGGRVTVIREVR
QAVPPGA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccatcattcccgactatctggccgaggtgctggagcaggtggaaccggacgcc
tccggggcgccggccgcctacatccccgaactggcggaggctgatcccgagcgcctcggc
gcggccttcgccaccgtcgacgggcgggtgcacggcgcgggcgacatcgacgtcccgttc
acgatccagtcgatctcgaagccgttcgcgtatgccctggcgctggccgaccgcggtttc
ggcacggtgctcgccaaggtgggcgtcgagccctcgggggaggcgttcaacgagatctct
ctggagagcggcacgggacgcccgctcaatcccatgatcaacgcgggtgcgatcaccgtt
cactccctggtcgcggaggcgggatccggtcccgccgaacgggtacgacgcgtgctcgac
ggcctctccgccttcgccggccgccgactggagacggacgagaaggtgtgcgcgtcggag
ctggagcacgcgcaccgcaacctcgccatcgcacacatgctgcgcggccacgacatcctg
accgaggacgtgcgggcggtcgtcgacggctacacccggcagtgctcggtgctcgtcacg
acgcgggatctggccgtcatggcggcgacactggccaaccgcggcgtgaacccgctctcg
ggggaacaggtggtgccggaaggggtcgtgcgccaggtgctgagcgtcatgttcagctgt
ggaatgtacgacgccgcgggtgactgggccacccaggtcggcatccccgcgaagagtggg
gtggccggaggcctgatcggcgcgcttcccggacgtatcggcatcgccaccttctcaccg
cgcctggacagccacggaaacagcgttcgcggggtatccctgttcgagcgtttctcctcc
gacatgggcctgcatgtgatggaggtcccctccgccgggcgggcggccgtgcggtccagc
cacgtcctcggcggcggaccggacgcgctccgcgttctggaactccagggcggcatcggc
ttcgccggagccgagcgcgtggtgcgggaggtcctggacaccgatccgcgggaggcccgg
gtggccatcgacctcacgcgggtccacgcgatcgacgacgtggcacggcgcatggtgctg
gagatcgcgcgccggctgacgctggacggccgggaggtattcctcgtcgatccggaggcg
gtcatccccgatcccgaccccggcgacggcggccgggtcaccgtcatccgcgaggtacgc
caagcggtgccacccggcgcgtga

DBGET integrated database retrieval system