KEGG   Streptomyces griseus: SGR_993Help
Entry
SGR_993           CDS       T00691                                 

Definition
(GenBank) putative fatty acid oxidation complex alpha-subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sgr  Streptomyces griseus
Pathway
sgr00071  Fatty acid degradation
sgr00280  Valine, leucine and isoleucine degradation
sgr00281  Geraniol degradation
sgr00310  Lysine degradation
sgr00362  Benzoate degradation
sgr00380  Tryptophan metabolism
sgr00410  beta-Alanine metabolism
sgr00640  Propanoate metabolism
sgr00650  Butanoate metabolism
sgr00903  Limonene and pinene degradation
sgr00930  Caprolactam degradation
sgr01040  Biosynthesis of unsaturated fatty acids
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01130  Biosynthesis of antibiotics
sgr01200  Carbon metabolism
sgr01212  Fatty acid metabolism
Module
sgr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sgr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SGR_993
   00650 Butanoate metabolism
    SGR_993
  Lipid metabolism
   00071 Fatty acid degradation
    SGR_993
   01040 Biosynthesis of unsaturated fatty acids
    SGR_993
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SGR_993
   00310 Lysine degradation
    SGR_993
   00380 Tryptophan metabolism
    SGR_993
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SGR_993
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SGR_993
   00281 Geraniol degradation
    SGR_993
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SGR_993
   00930 Caprolactam degradation
    SGR_993
Enzymes [BR:sgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SGR_993
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SGR_993
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SGR_993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DAO F420_oxidored AlaDh_PNT_C NAD_Gly3P_dh_N NAD_binding_8 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BAG17822
Kitasato: SGR993
UniProt: B1VTX8
Position
complement(1173578..1175752)
Genome map
AA seq 724 aa AA seqDB search
MTESTTIRWEQDETGVVTLVLDDPNQSANTMNQAFKDSIAAVADRAEAEKDSIRGIIYTS
AKKTFFAGGDLKDMIKVGPENAQDAFDAGNAIKASLRRIETLGKPVVAAINGAALGGGYE
IALACHHRVALDAPGSRIGLPEVTLGLLPAGGGVTRTVRLMGIADALLKVLLQGTQYTPR
RALENGLVHEVAATREEMTEKARAFIDAHPESQQPWDVKGYRIPGGTPSNPKFAANLPAF
PANLKKQLAGAPMPAPRNILAAAVEGSQVDFETALTIEARYFTELVTGQVSKNMIQAFFF
DLQAVNSGANRPGGIPERPVRKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSAEAAAKGK
AYSEKLLAKALSRGRTTEAKRDELLARITPTGDAADLAGCDAVIEAVFEDTALKHKVFQE
IQDVIEPDALLCSNTSTLPITVLAEGVSRPVDFIGLHFFSPVDKMPLVEIIKGERTGDEA
LARAFDLVRRIKKTPIVVNDSRGFFTSRVIGQFINEGVAMVGEGVEPASIEQAAAQSGYP
AKVLSLMDELTLTLPRKIRNETRRAVEEAGGSWPGHPSDEVIDRMVDEFGRTGRSGGAGF
YDYDEDGKRAGLWPGLREHFTGKADGDVPFEDMKERMLFSEALDSVRCLEENVLISVADA
NIGSIMGIGFPPWTGGVLQYINGYEGGLPGFVARARELAERYGDRFLPPALLVEKAEKGE
TFHD
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagcaccaccatccgctgggaacaggacgagaccggcgtcgtcaccctcgtc
ctcgacgacccgaaccagtccgccaacacgatgaaccaggccttcaaggactccatcgcg
gccgtcgccgaccgcgccgaggccgagaaggactccatccgcggcatcatctacacctcc
gccaagaagaccttcttcgccggcggcgacctcaaggacatgatcaaggtcggcccggag
aacgcccaggacgccttcgacgccggcaacgccatcaaggcctcgctgcgccgcatcgag
accctcggcaagcccgtcgtcgccgccatcaacggggcggccctcgggggcggttacgag
atcgccctcgcctgccaccaccgcgtcgccctcgatgcccccggctcccgcatcggcctg
cccgaggtcaccctcggcctgctcccggcgggcggcggcgtcacccggaccgtacgcctc
atgggcatcgcggacgccctgctcaaggtgctcctccagggcacccagtacaccccgcgg
cgggccctggagaacggcctggtccacgaagtcgccgccacccgcgaggagatgaccgag
aaggcccgcgccttcatcgacgcccacccggagtcccagcagccctgggacgtcaagggc
taccggatccccggcggcaccccgtccaaccccaagttcgccgccaacctccccgccttc
ccggccaacctgaagaagcagctcgcgggcgcgcccatgcccgccccgcgcaacatcctc
gcggcggccgtcgagggctcccaggtcgacttcgagaccgccctgaccatcgaggcccgg
tacttcaccgagctggtcaccggccaggtctccaagaacatgatccaggcgttcttcttc
gatctccaggccgtcaactccggcgccaaccggccggggggcatcccggagcgcccggtc
cgcaaggtcgccgtgctcggcgccgggatgatgggcgcgggcatcgcctactcctgcgcc
agggccggcatcgacgtcgtcctcaaggacgtctccgccgaagcggccgccaagggcaag
gcctacagcgagaagctgctcgccaaggcgctctcccggggccgtacgacggaggcgaag
cgcgacgagctgctggcccggatcacccccaccggcgacgcggccgacctcgcgggctgc
gacgcggtgatcgaggccgtcttcgaggacacggccctcaagcacaaggtgttccaggag
atccaggacgtcatcgagcccgacgccctgctctgctccaacacctccacgcttcccatc
acggtcctcgccgagggggtctcacgccccgtcgacttcatcggcctgcacttcttctcc
ccggtcgacaagatgccgctggtcgagatcatcaagggcgagcggaccggcgacgaggca
ctggcccgcgccttcgacctcgtacggcgcatcaagaagacgccgatcgtcgtcaacgac
tcccgcggcttcttcacctcccgcgtcatcggccagttcatcaacgagggcgtcgccatg
gtcggcgagggcgtcgagcccgcctcgatcgagcaggccgccgcccagtccggctacccg
gccaaggtgctctccctgatggacgagctgaccctgaccctgccccgcaagatccggaac
gagaccaggcgggcggtggaggaggccggcggcagctggcccgggcacccctccgacgag
gtcatcgaccgcatggtcgacgagttcggccgcacggggcgcagcgggggagcaggcttc
tacgactacgacgaggacggcaagcgcgccggcctctggccgggcctgcgcgagcacttc
accggcaaggccgacggggacgtccccttcgaggacatgaaggagcggatgctcttctcc
gaggcgctggacagcgtccgctgcctggaggagaacgtcctcatctccgtcgcggacgcc
aacatcggctccatcatgggcatcggcttcccgccgtggaccggcggcgtcctccagtac
atcaacgggtacgagggcggcctgcccggcttcgtggcccgcgcccgggaactcgccgag
cgttacggcgaccgcttcctgccgcccgcgctgctggtggagaaggcggagaagggcgag
accttccacgactga

DBGET integrated database retrieval system