KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0134Help
Entry
SGGB_0134         CDS       T02018                                 

Gene name
galM
Definition
(RefSeq) aldose 1-epimerase (EC:5.1.3.3)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGB_0134 (galM)
   00052 Galactose metabolism
    SGGB_0134 (galM)
Enzymes [BR:sgt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SGGB_0134 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144416..145447
Genome map
AA seq 343 aa AA seqDB search
MEVKQEIVETINGQKVEKYTIVNDNGVQVGLLTLGATWQEFLVPDDKGGQKNLIIGFDKP
SDYLKNPLCAGQSIGRVAGRINQGKVNLDGKEIQLPQNEKGNTLHGGSQGFHQQIWTAFI
EAGQNALSVVMTYDAKEEIDHFPGDMQVEVRFTLDNANRFTIVYTGKNATKTTLFNPTNH
VYFNLGNRQDLSQHTFTLAADHYLETRDDLIPTGKFIDVAGTAYDFQTGQNLGEAIADTG
GLDDAFLVNASLDKTCGELKDDESGDSVHLYSDRDAWVVYSMGGIPEGIYPARDKGKMAK
EFEALALEAQFLPDAINHDNFGDITLQANEEKSYTIAFEYHKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaacaagaaattgttgagacaattaatgggcaaaaggttgaaaaatacact
attgttaatgataatggtgtccaagttggtttactaacgctgggagcaacttggcaagaa
tttttagtgccagatgacaaaggtggtcagaaaaatcttatcattggttttgataagccg
agtgattatctgaaaaatcctttatgtgcaggtcaatcaatcggacgtgttgcagggcgt
attaatcaagggaaagttaaccttgatggcaaagaaattcagctaccacaaaacgaaaaa
ggaaacactcttcacggtggctctcaaggatttcatcagcaaatctggactgcatttatc
gaagctggtcaaaatgcgcttagtgtggtgatgacttatgacgctaaagaggaaattgac
catttcccaggagatatgcaggtagaagtacgatttacgctagacaatgcaaatcgtttt
acgattgtttatacgggcaaaaatgctactaaaacaacgctttttaacccaactaaccat
gtttattttaacttgggaaatcgtcaagatttaagtcagcacaccttcactttggcagct
gaccattatttagagactcgtgatgatttgattccgacaggaaaattcattgacgttgct
ggcacagcttatgattttcaaactgggcaaaaccttggagaggctatcgctgatacaggc
gggcttgacgatgctttcttggtaaatgcttcgcttgataaaacttgtggagaattgaaa
gatgatgaaagtggcgattctgttcacctttattctgaccgtgatgcttgggtcgtttac
agcatgggtggcattcctgaaggtatttatccagcgcgtgataagggcaaaatggctaaa
gaatttgaagccttagcgcttgaagcacaatttctcccagatgctattaatcatgataat
tttggtgacattaccctgcaagcaaatgaggagaaaagctacacaattgcttttgagtat
cataaagaataa

DBGET integrated database retrieval system