KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0134Help
Entry
SGGB_0134         CDS       T02018                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgt00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sgt00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
144416..145447
Genome map
AA seq 343 aa AA seqDB search
MEVKQEIVETINGQKVEKYTIVNDNGVQVGLLTLGATWQEFLVPDDKGGQKNLIIGFDKP
SDYLKNPLCAGQSIGRVAGRINQGKVNLDGKEIQLPQNEKGNTLHGGSQGFHQQIWTAFI
EAGQNALSVVMTYDAKEEIDHFPGDMQVEVRFTLDNANRFTIVYTGKNATKTTLFNPTNH
VYFNLGNRQDLSQHTFTLAADHYLETRDDLIPTGKFIDVAGTAYDFQTGQNLGEAIADTG
GLDDAFLVNASLDKTCGELKDDESGDSVHLYSDRDAWVVYSMGGIPEGIYPARDKGKMAK
EFEALALEAQFLPDAINHDNFGDITLQANEEKSYTIAFEYHKE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcaaacaagaaattgttgagacaattaatgggcaaaaggttgaaaaatacact
attgttaatgataatggtgtccaagttggtttactaacgctgggagcaacttggcaagaa
tttttagtgccagatgacaaaggtggtcagaaaaatcttatcattggttttgataagccg
agtgattatctgaaaaatcctttatgtgcaggtcaatcaatcggacgtgttgcagggcgt
attaatcaagggaaagttaaccttgatggcaaagaaattcagctaccacaaaacgaaaaa
ggaaacactcttcacggtggctctcaaggatttcatcagcaaatctggactgcatttatc
gaagctggtcaaaatgcgcttagtgtggtgatgacttatgacgctaaagaggaaattgac
catttcccaggagatatgcaggtagaagtacgatttacgctagacaatgcaaatcgtttt
acgattgtttatacgggcaaaaatgctactaaaacaacgctttttaacccaactaaccat
gtttattttaacttgggaaatcgtcaagatttaagtcagcacaccttcactttggcagct
gaccattatttagagactcgtgatgatttgattccgacaggaaaattcattgacgttgct
ggcacagcttatgattttcaaactgggcaaaaccttggagaggctatcgctgatacaggc
gggcttgacgatgctttcttggtaaatgcttcgcttgataaaacttgtggagaattgaaa
gatgatgaaagtggcgattctgttcacctttattctgaccgtgatgcttgggtcgtttac
agcatgggtggcattcctgaaggtatttatccagcgcgtgataagggcaaaatggctaaa
gaatttgaagccttagcgcttgaagcacaatttctcccagatgctattaatcatgataat
tttggtgacattaccctgcaagcaaatgaggagaaaagctacacaattgcttttgagtat
cataaagaataa

DBGET integrated database retrieval system