KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0239Help
Entry
SGGB_0239         CDS       T02018                                 

Gene name
ycjM
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sgt00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
238719..240164
Genome map
AA seq 481 aa AA seqDB search
MGIQNKTMLITYSDSLGKNLKELKQNLDKYFGEAVGGIHLLPFFPSTGDRGFAPVDYDEV
DSTFGTWDDVKGLGENYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDMFLNWDKFWPE
NRPTQVDVDLIYKRKDRAPKQEIHFTDGSVEHLWNTFGEEQIDLDVTKEVTMDFIRKTIK
HLAENGCDLIRLDAFAYAVKKLDTNDFFVEPDIWELLDKVRSIAAESGTELLPEIHEHYS
IQFKIAEHDYYVYDFALPMVTLYSLYSRKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDDEIDYTSSELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKKYFLARLI
QVFAPGIPQVYYVGFLAGKNDLDLLEKTKEGRNINRHYYTNEEIAEEVRRPVVQALLKLF
TFRNQSAAFDLDGSIDVEILDENTLVITRRNQGSSVVAEAQINLKELSYAVKENGEEVTF
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgggaattcaaaataaaacaatgttaatcacttactcggatagtctgggtaaaaattta
aaagaacttaaacaaaatcttgataagtatttcggggaggcagttggtggtatccatcta
ttgccattctttccgtcaactggtgaccgtggttttgcccctgtcgattatgatgaggta
gattctacatttggtacttgggatgatgtgaaaggcttgggtgaaaactattatcttatg
tttgatttcatgattaaccatatttctcgtcaatcaaaatattacaaagattatcaagaa
aaacatgaagctagtgcttacaaggatatgtttcttaactgggataaattttggccagaa
aatcgtccgacacaagttgatgtggacttgatttacaagcgtaaagaccgcgcaccaaaa
caagaaattcattttacagatggttcggttgagcatttgtggaatacatttggtgaggaa
caaattgaccttgacgtgacaaaagaagtgaccatggatttcattcgaaaaaccatcaaa
cacctagcagaaaatggatgtgacctcattcgtctagatgcatttgcttatgcagttaag
aaattggataccaatgatttctttgtggagccagacatttgggaattacttgataaagtg
cgtagcattgcagcggaatctggtacagaattgcttccagaaattcatgagcactattca
atccagtttaagattgctgagcatgactattatgtctatgattttgcacttccaatggtg
acgctttatagcctatatagcagaaaagttgaccgtttggcaaaatggttgaaaatgtcg
ccgatgaagcaatttacaacgcttgatacacatgatggaattggtgtggttgatgtcaaa
gatattttgacagatgatgaaattgattatacctccagtgaactttataaagttggtgct
aatgtcaaacgtaaatactcatctgctgaatacaataatctcgatatttatcagattaat
tcgacttattattctgcacttggtgatgatgacaagaaatatttcttagcacgcttgatt
caggtttttgccccgggtattccacaagtttattatgttggatttttagcaggaaaaaat
gatcttgatttgttagaaaaaacaaaagaaggccgcaacatcaatcgtcattattacacg
aatgaagaaattgctgaagaagtccgacgcccagtagttcaagctttgctcaaactcttt
acttttcgaaatcaatcagctgcttttgaccttgatggcagtattgatgtagagatatta
gatgaaaatacgcttgtaatcactcgccgtaatcaaggtagcagtgtggttgcggaagcc
caaattaatttaaaagagttaagctacgcagttaaagaaaacggggaagaagttactttc
ttataa

DBGET integrated database retrieval system