KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0262Help
Entry
SGGB_0262         CDS       T02018                                 

Gene name
adhE
Definition
bifunctional acetaldehyde dehydrogenase/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGGB_0262 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGB_0262 (adhE)
   00620 Pyruvate metabolism
    SGGB_0262 (adhE)
   00650 Butanoate metabolism
    SGGB_0262 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SGGB_0262 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGGB_0262 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGGB_0262 (adhE)
   00626 Naphthalene degradation
    SGGB_0262 (adhE)
Enzymes [BR:sgt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGGB_0262 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SGGB_0262 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265557..268238
Genome map
AA seq 893 aa AA seqDB search
MAKATNADVKNNELSAEEAAQQYTGALVDKALEAERVYATYSQEQVDKIVAAMALAGSEA
SLELAKEAHAETGRGVVEDKDTKNHFATEYVYERIKNEKTVGIIGEDKVSGSIQIAAPLG
VLAGIVPTTNPTSTTMFKILVALKTRNAIVFAFHPQAQKCSAHAAKILYDAAVKAGAPEN
IVQWIETPSIANTTALIQNKKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDATA
HIDRAVEDLLLSKRFDNGMICATENSAVVEAPVYKEWLQKMQDKGAYLVPKKDYKKIEDF
VFNDNHGVNGPVAGMPATWICEQAGVKLPEGKDVLLFELDKKNIGEKLSSEKLSPLLSVY
KAKDREEGIEIVEALLDYQGAGHNAGIQIGSQADPFVATYGDAVKASRVLVNQPDSVGGI
GDVYTDALKASLTLGTGSWGKNSLSHNLSTGDLLNIKTVAKRRNRPQWIRLPEKTYYEKN
AISYLQDEYEPMQRALIVADPGMVQFGFVDTVLAQLALRDEKVATSIYGTIKPDPTLGQT
IEIAKQMRDFKPDTVIAIGGGSAIDASKIARLIYEVYLDRGDEFLDSYDAVSEFFLELQQ
KFIDIRKRIVKFKHQTTTRLFCIPTTSGTGAEVTPFAVITDDYTHVKYPLADYELVPQVA
IVDPEFVMTVPKRTAAWSGLDALSHALESYVSVMASDFTRPWSLEAIKLIIENLEDAYNY
DPKNPTLRGEKAKENMHYAAAIAGMAFGNAFLGINHSLAHKTGGEFGLPHGLAISIAMQH
VIRYNGVSGNVKRSVYPRYEEYRAQKDYADIARYIGLKGKDDAELVEALCDRIDKLMHAV
DVEPKLSANGVTKEAFDAAVDRLASLAYDDQCTPANPRQPYISELKQLLIDMF
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaacaaatgcagatgtaaagaataacgagttgagcgctgaagaagcagcc
cagcagtacacaggggctcttgtcgataaagctcttgaagctgagcgcgtttatgcaact
tattcacaagaacaagttgataaaattgtagcagctatggctctcgcaggttctgaagct
tcgctagaattggcaaaagaagcacatgccgaaactggtcgtggtgtcgttgaggataaa
gatactaaaaaccacttcgcaacagaatacgtttacgaacgtatcaaaaatgaaaaaaca
gttggtatcattggtgaagataaggtttctggaagtattcaaattgcagcacctcttggt
gttttagcaggtattgtcccaacaacaaacccaacatcaacaacaatgtttaaaattttg
gtagcgttgaaaacacgtaatgccattgtttttgcattccacccacaagcacaaaaatgt
tcagctcatgcagcaaaaattctttacgacgctgcggtgaaagctggtgctcctgaaaat
attgtccaatggattgaaacgccatcaatcgctaacacaacagcccttatccaaaacaag
aaaattgcttctattttggcaactggtggacctggtatggtaaatgcagcccttaaatca
ggtaacccatcaatgggtgttggtgcaggtaatggtgctatctatgttgatgcaactgct
catattgaccgcgctgtggaagacttgttgttatcaaaacgctttgataatggtatgatt
tgtgcgactgaaaattcagcagtcgttgaagcgccagtttacaaagaatggttgcaaaaa
atgcaagataaaggtgcttacttagtacctaagaaggactacaagaaaattgaagacttt
gttttcaatgacaaccatggtgtaaacggtcctgttgccggaatgccagcaacttggatt
tgtgaacaagctggtgtgaaattgccagaaggtaaagatgttctcttgtttgagcttgac
aagaaaaacatcggtgaaaaactatcatcagaaaaattgtctccactcctttcagtgtac
aaagctaaagatcgtgaagaaggtatcgaaattgttgaagcgcttcttgattatcaaggt
gcaggacacaatgccggtatccaaattggttcacaagcagacccatttgtagcaacatat
ggcgatgccgtgaaagcatcacgtgtcttggttaaccaaccagattcagtcggaggtatc
ggtgatgtctatacagacgcacttaaagccagcttaacacttggaacaggatcatggggg
aaaaattcattgtcacacaatctttcaactggcgatctcttaaatatcaagactgttgcg
aaacgtcgtaaccgtccacaatggattcgcttaccagaaaaaacttactacgaaaagaat
gctatctcatatttgcaagatgaatatgaaccaatgcaacgtgctttgattgtagcagac
ccaggtatggttcaatttggatttgttgacactgtccttgctcaattggcattgcgtgat
gaaaaagtcgcaacatcaatttacggaacaatcaaaccagacccaactcttggacaaaca
atcgaaattgcaaaacaaatgcgtgatttcaaaccagatacagttattgcaattggtggt
ggctctgctattgatgcatctaagattgcacgtttaatttatgaagtttatcttgaccgt
ggtgatgaattccttgatagttatgatgctgttagcgaatttttccttgaattgcaacaa
aaattcattgatattcgtaaacgtattgtgaaattcaaacatcaaacaacaacacgtctc
ttctgtatcccaaccacatctggtacaggtgctgaggtgacaccatttgcggttattact
gatgattatacacacgtgaaatacccacttgctgattatgaattggtaccacaagttgct
attgttgatccagaatttgttatgactgtgccaaaacgtacagcagcttggtcaggatta
gatgctttgtcacatgctcttgaatcttacgtatcagttatggcatctgactttacacgt
ccatggtctcttgaagctatcaagttgattattgaaaatcttgaagatgcttataactac
gatcctaagaatccaacacttcgtggtgaaaaagctaaagaaaacatgcattatgcagca
gctattgctggtatggcatttggtaatgctttcttaggtatcaaccattcacttgctcac
aaaacaggtggtgaatttggacttccacacggtttagctatttcaatcgcaatgcaacat
gttatccgctataacggtgtatctggtaatgttaaacgctcagtttacccacgttatgaa
gaataccgtgctcaaaaagattacgcagatattgcgcgttacattggtcttaaaggtaaa
gatgatgcagaattagtcgaagcactttgcgaccgcattgataaattgatgcatgctgtt
gacgttgaaccaaaactttctgctaatggtgttacaaaagaagcctttgatgcagcagtt
gatcgtttggcaagtttggcatatgatgaccaatgtactccagcaaacccacgtcaacca
tacatttcagaattgaaacaacttttgattgatatgttctaa

DBGET integrated database retrieval system