KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0438Help
Entry
SGGB_0438         CDS       T02018                                 

Gene name
proB
Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGB_0438 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SGGB_0438 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SGGB_0438 (proB)
Enzymes [BR:sgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SGGB_0438 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
449785..450588
Genome map
AA seq 267 aa AA seqDB search
MKRNFETVNRIVIKIGTSSLVMPNGKINLEKIDQLAFVISSLMNKGKDVILVSSGAMGFG
LNVLNMDKRPTEIARQQAVSSVGQVAMMSLYSQIFSHYQTEVSQLLITRDVIEYPESLEN
FTNAFEMLLTMGIVPIVNENDAISVDEMDHTTKFGDNDRLSAIVAKVTKADLLIMLSDID
GLYDKNPNIYDDAKLREHVTEITDEIIKSAGGAGSKFGTGGMLSKIKSAQMIFDNNSQMI
LMNGANPRDILKALEGANIGTWFSQVN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaattttgaaactgttaatcgaattgttataaaaattgggacaagctcgctt
gtcatgccaaatggcaaaattaatcttgaaaaaattgaccaactagcttttgttatctct
agcttgatgaataaaggaaaagatgttattttggtgtcatctggtgccatgggatttggg
ctcaatgtgttaaatatggacaaacgtccgacagaaattgcacgtcaacaggcggtgtca
agtgttgggcaggttgccatgatgagcctttattctcaaatcttttcgcattatcagaca
gaagttagtcagctgttgattacacgtgatgttattgaatatcctgaaagcttagaaaat
ttcactaatgcctttgaaatgttattaacaatgggaattgtgccaatcgttaacgaaaac
gatgctattagcgttgatgaaatggaccacacgacaaaatttggtgataatgaccgactt
tcagcgattgtagccaaggtaaccaaagcagatttgttaatcatgttatcagatattgac
ggactttacgataaaaatccaaatatctatgatgatgccaaacttcgcgaacacgttact
gaaattacggacgaaatcattaaatcagcgggcggtgctggaagtaaatttggcacggga
ggcatgctcagcaagattaagagtgctcaaatgatttttgacaataacagtcagatgatt
ttgatgaacggtgcaaatccgcgtgatattttaaaagctctagaaggtgctaatattgga
acgtggttttcacaagtgaattaa

DBGET integrated database retrieval system