KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0553Help
Entry
SGGB_0553         CDS       T02018                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sgt01100  Metabolic pathways
sgt01110  Biosynthesis of secondary metabolites
sgt01130  Biosynthesis of antibiotics
sgt01230  Biosynthesis of amino acids
Module
sgt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGB_0553 (trpC)
Enzymes [BR:sgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SGGB_0553 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: BAK27446
UniProt: F5WZI5
Position
573194..573961
Genome map
AA seq 255 aa AA seqDB search
MSKEFLPTILKQKAKEVEELETESLQPLRETYKLYDYLKNNAKKLQVIAEVKKASPSLGD
INLDVDIVKQAKTYQDSGAAMISVLTDPFFFKGDIDYLRQISSQVSIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALPEARLKELYDFATGLGLEVLLETHNLPELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSAHFKEMPVYISESAIFTKDDATLVAPFFNGILVGTALMKA
DNVSEKVKELQIDEG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaatttctcccaactatcttgaagcaaaaagcaaaagaagtggaagagtta
gaaacggaatccttacaaccacttcgtgagacttacaagctgtatgactatctcaaaaat
aatgccaagaaacttcaagtgattgctgaagtcaaaaaagctagtcctagccttggtgac
attaatcttgatgtcgacattgtcaaacaagctaaaacttaccaggatagcggtgcggca
atgatttcggtgctgacagaccctttcttctttaaaggtgacattgattacctccgtcag
atttctagtcaagtgagtattccaacgcttgccaaagatttcattattgatgaaaaacaa
atcattcgtagtcgtaatgcaggagcaacagtgattttgttgattgtggcagctttgcca
gaagctcgcttgaaagagctttatgattttgcgacagggttaggactagaagttttactc
gaaacgcataatttacctgaattggaagtcgcacatcgcattggtgctaaaattatcggc
gttaataaccgtaatttagtgacttttgaaacagatattaataccagcttagaattatca
gcgcattttaaagaaatgccagtttatatttcagaatcagctattttcaccaaagacgac
gctaccttggttgccccatttttcaatggcatcttagttggcacggcattgatgaaagca
gataatgtttctgaaaaagtgaaggagttgcaaattgacgaaggttaa

DBGET integrated database retrieval system