KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0553Help
Entry
SGGB_0553         CDS       T02018                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (EC:4.1.1.48)
  KO
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGB_0553 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGB_0553 (trpC)
Enzymes [BR:sgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SGGB_0553 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
573194..573961
Genome map
AA seq 255 aa AA seqDB search
MSKEFLPTILKQKAKEVEELETESLQPLRETYKLYDYLKNNAKKLQVIAEVKKASPSLGD
INLDVDIVKQAKTYQDSGAAMISVLTDPFFFKGDIDYLRQISSQVSIPTLAKDFIIDEKQ
IIRSRNAGATVILLIVAALPEARLKELYDFATGLGLEVLLETHNLPELEVAHRIGAKIIG
VNNRNLVTFETDINTSLELSAHFKEMPVYISESAIFTKDDATLVAPFFNGILVGTALMKA
DNVSEKVKELQIDEG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaatttctcccaactatcttgaagcaaaaagcaaaagaagtggaagagtta
gaaacggaatccttacaaccacttcgtgagacttacaagctgtatgactatctcaaaaat
aatgccaagaaacttcaagtgattgctgaagtcaaaaaagctagtcctagccttggtgac
attaatcttgatgtcgacattgtcaaacaagctaaaacttaccaggatagcggtgcggca
atgatttcggtgctgacagaccctttcttctttaaaggtgacattgattacctccgtcag
atttctagtcaagtgagtattccaacgcttgccaaagatttcattattgatgaaaaacaa
atcattcgtagtcgtaatgcaggagcaacagtgattttgttgattgtggcagctttgcca
gaagctcgcttgaaagagctttatgattttgcgacagggttaggactagaagttttactc
gaaacgcataatttacctgaattggaagtcgcacatcgcattggtgctaaaattatcggc
gttaataaccgtaatttagtgacttttgaaacagatattaataccagcttagaattatca
gcgcattttaaagaaatgccagtttatatttcagaatcagctattttcaccaaagacgac
gctaccttggttgccccatttttcaatggcatcttagttggcacggcattgatgaaagca
gataatgtttctgaaaaagtgaaggagttgcaaattgacgaaggttaa

DBGET integrated database retrieval system