KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0555Help
Entry
SGGB_0555         CDS       T02018                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGB_0555 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGGB_0555 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGB_0555 (trpB)
Enzymes [BR:sgt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGGB_0555 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
574526..575728
Genome map
AA seq 400 aa AA seqDB search
MSYNQPDTNGFYGKFGGQFVPETLMTAVIELDEAYREAKADPSFQEELDALLKNYVGRET
PLYYAERLTKHIGGAKIYLKREDLNHTGAHKINNALGQVLLAKRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVFSVTDGSRVLKDAVNAALRA
WVANIEDTHYIMGSALGPAPFPEMVRDFQSVIGQEAKEQYAEISGGKLPDAVLACVGGGS
NAIGLFYPFVEDESVALYGAEAAGHGLDTEEHAATFAKGRIGILHGALMNVLQDRHGQIM
EAFSISAGLDYPGVGPEHCHFKDIGRATYDSITDDEALEAFMLLSRLEGIIPALESSHAI
ALTQKVAKELGPDKSIIVCLSGRGDKDVVQVKERLEAEGK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagctataaccaaccagatactaatggattttacggaaaatttggtggacaatttgtt
cccgaaacgctgatgactgcggttatcgaacttgatgaagcttaccgcgaagctaaggca
gacccaagctttcaagaagaactcgatgcgcttttgaaaaattatgtcggtcgtgaaaca
ccgctttattatgcagagcgtttaacaaaacatatcggcggtgcgaaaatttacctcaaa
cgtgaagaccttaaccacacaggtgctcataaaattaataatgccctcggtcaagttctc
cttgctaaacgaatgggcaaaaagaaaatcattgccgaaactggtgctggtcaacacggg
gttgcaacagcaacagcagctgcactttttgacatggaatgtacgatttacatgggtgaa
gaggacgtgaaacgccaagcactcaatgttttccgtatggaattgctaggcgctaaagtc
ttttctgtaactgatggttcacgcgttttgaaagatgccgtaaatgcagcccttcgcgcg
tgggtagctaatatcgaagatacacactacatcatggggtcagctctcggacctgcacct
ttccctgaaatggttcgtgacttccaatctgttatcggtcaagaagcaaaggaacaatat
gcagagatttcaggaggaaaattgcctgatgctgtcctagcctgtgttggcggtggttca
aatgcgattggtcttttctatccatttgtcgaagatgaatcagttgctctttacggtgct
gaagcagcaggacatgggcttgatactgaagaacacgctgcaacatttgccaaaggacgt
ataggtattttgcatggtgctttgatgaatgttttgcaagaccgtcatggacaaatcatg
gaagctttctcaatctcagctggtcttgattatccaggcgttggtccagaacattgccat
tttaaagacattggtcgtgcaacatacgattctattaccgatgatgaagcacttgaagca
ttcatgcttctatcacgtttggaagggattattccggccctcgaatcaagtcatgccatt
gctttgactcaaaaagtggctaaggaattaggaccagataaatcaatcattgtttgtcta
tctggacgtggtgataaggatgttgtgcaagtaaaagaacgtttggaagcagaagggaaa
tag

DBGET integrated database retrieval system