KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0556Help
Entry
SGGB_0556         CDS       T02018                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SGGB_0556 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGGB_0556 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SGGB_0556 (trpA)
Enzymes [BR:sgt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SGGB_0556 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575732..576514
Genome map
AA seq 260 aa AA seqDB search
MTKTLTKHLENIAASGKGIFVPYIMAGDHEKALDGLFDTITFLENSGASAIEVGIPWSDP
VADGPVIELAGQRSLANGVNLTAIVQKLQEKQTTVPLVIMTYINPVYQYGIEKFIADLKN
TSVKGLIIPDLPHEHENMVKPYLTDTDIALVPLVSLTTGIERQKTLCKDAEGFIYAVAIN
GVTGKTGNYRDDLDKHLTNLKAIADIPVLTGFGVSTPADIERFNKVSDGVIVGTKIVRDL
HEGKTDDVADFVKYGSNYQK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaagacactcacaaaacatcttgaaaacattgcagcaagcggtaaaggaattttt
gtgccatacattatggcaggagaccacgaaaaagctttagacggtttgtttgacaccatt
acttttttggaaaatagcggagcttctgctattgaagtgggcattccatggtcagacccc
gttgctgacggaccagtcattgaattagcagggcaaagaagcttggctaacggtgtgaat
ttaacagcgattgttcaaaaattacaagaaaaacaaacgacagttcctttggtcatcatg
acttacatcaatcctgtctatcaatacggcattgagaaatttattgctgacttgaaaaat
acgtctgttaaagggttgattattcctgatttaccacacgaacacgaaaatatggtaaaa
ccatatcttaccgacacagatattgcgcttgtgccactcgttagtctgacaacaggtatt
gaacgtcaaaaaacgttatgtaaagatgctgaaggatttatctatgccgttgctattaac
ggtgttactggtaaaactggtaattatcgtgatgatttggataaacatttgaccaatctt
aaagccattgcagacattcctgttttaacaggttttggtgtctcaactccagcggacatt
gagcgctttaacaaagtatcagacggtgttattgtcggaacgaaaattgttagagactta
cacgaaggaaaaacagatgatgttgctgactttgtcaaatacggctcaaattatcaaaaa
taa

DBGET integrated database retrieval system