KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0755Help
Entry
SGGB_0755         CDS       T02018                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sgt00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sgt00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786771..788030
Genome map
AA seq 419 aa AA seqDB search
MRKIVINGGKPLKGEVAISGAKNSVVALIPAAILADDIVILDGVPAISDVDSLIEIMEIM
GAKVKREEDTLEIDPRGIKNQPMPYGKINSLRASYYFYGSLLSRFGEATVGLPGGCDLGP
RPIDLHLKAFEAMGAAISYEGEAMRLATNDESIHGAHIYMDTVSVGATINTMLAATKANG
RTIIENAAREPEIIDVATLLNNMGAHIRGAGTDVITIEGVDYLHGTRHQVIPDRIEAGTY
IAMAAAMGEGVRITNVLYEHLESYIAKLEEMGVRMTVEEDSIFVEKQSVLKAVSVKTSPY
PGFATDLQQPITPLLLTAEGRGTILDTIYEKRTNHVAELVRMGADISIVGGRIAYQGPNK
LTGAPVKASDLRAGAALVIAGLMAEGQTEITNVEFILRGYSNIIEKLTALGADIKLIED
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaattgtaattaatggtggcaagcctttaaaaggtgaggttgctatttcaggt
gcaaagaatagtgtagttgctttgattcctgcagctattcttgcagatgatattgtcata
ttagatggcgttcctgccatttccgatgttgatagtttaattgaaatcatggaaatcatg
ggcgccaaagtgaaaagagaagaagatacccttgaaattgatccacgtggcataaaaaat
caaccaatgccttatggtaagattaatagtttacgtgcctcttattatttctatggtagt
ttgttaagtcgttttggtgaggctacagtaggtcttccaggtggttgtgaccttggacct
cgtccgattgatttgcaccttaaagcttttgaagccatgggagctgcgatttcgtatgaa
ggcgaagcgatgcgtttggcgacaaatgatgagtctattcatggtgcacatatctatatg
gatacggttagtgttggagcaacgattaatacgatgcttgcagcaactaaggcaaatggt
cgtacgattattgaaaatgctgcgcgtgagccagaaatcattgacgtagctactttgtta
aacaatatgggagctcacattcgtggtgctggtacagatgtgattacaattgaaggtgtt
gattaccttcatggcacacgtcaccaagtcattcctgaccgtattgaagctggtacttat
attgccatggcagcagcaatgggtgagggggttcgtattaccaatgtcctttatgaacac
ttagagagttacattgcaaaactcgaagaaatgggcgttcgtatgacggttgaagaggat
tctatctttgttgaaaaacaatcagtattgaaagccgtatcagtgaaaacgtcaccatat
ccaggttttgcgactgatttgcaacaaccaatcacaccgttgttgttgacagctgaggga
cgtggtactatcctcgataccatttatgaaaaacgtactaatcacgttgctgaattggta
cgaatgggtgctgatatttctattgttggtggtcgtattgcttaccaaggacctaataaa
ttaacaggagctcctgttaaagcctctgatttgcgtgcaggtgcagcgcttgttattgca
ggtttaatggcagaaggtcaaacagaaattaccaacgttgaatttattttgcgcggttat
tcaaatatcattgaaaaattaacagccctaggcgctgatattaaattaattgaagattaa

DBGET integrated database retrieval system