KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0765Help
Entry
SGGB_0765         CDS       T02018                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGGB_0765 (glgB)
Enzymes [BR:sgt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SGGB_0765 (glgB)
Exosome [BR:sgt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SGGB_0765 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798449..800353
Genome map
AA seq 634 aa AA seqDB search
MMDTKEALRTFGTGENFHAQHYFGFHKETRNGTEGYSFRVWAPNAQSVHLIGDFTQWREN
PLAMERNEAGVWEIFTDLPKENQLYKYLVKRSTGQEVEKLDPFAIYFEKRPGTAAVLTDF
PEKKWKDALWLGRRKRFGFRNRPVNIYEVHAGSWKQHDDGRPYQFKELTEELIPYLVKMN
YTHVEFMPLMAHPLGMSWGYQLMGYFAFEHSYGTPEDFQNFVETCHLNNIGVIVDWVPGH
FTINDDALAYFDGTPTFEYEDEDRAHNRGWGALNFDLGKNQVQSFLISSAKFWIDYYHLD
GIRVDAVSNMLYRDYDIGPWTPNKDGGNRNYEGYYFLQKLNAVLKSFYPDIMMIAEESTS
DTKITGPIEYDALGFDYKWNMGWMNDILKFYEEDPIYRKYDFNLVTFSFMYAFSENFILP
FSHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEFGQFLEWKYDY
QLEWVNLEDDLNKKMQDFTSQLNAFYKEHNVLWQIDDSYDGIEIIDADNTDQTVLSFIRK
NKDGDMLICVFNMVPVERKDFTIGVPVAGIYEEVWNTEMEEFGGVWKEHNLQARTQDRLW
KNYHHTLSFTLPALGASIWKIKRRLAKQIPKKGK
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgatggacacgaaagaggcactgagaacttttggaacgggtgaaaattttcatgcgcaa
cattactttggctttcataaagaaactcgtaatggtaccgaaggttacagttttagagtc
tgggcacccaacgctcaatctgttcatctgattggtgatttcactcaatggagagaaaat
ccgcttgctatggaacgcaacgaagcaggtgtatgggaaatttttacggatttacctaaa
gaaaatcaactttacaagtatcttgtaaaacgttcgactggtcaagaagttgaaaaatta
gacccatttgctatttatttcgaaaagcgaccagggacagcagcagttcttacagatttt
ccagaaaagaagtggaaagatgcactttggttagggcgacgcaaacgtttcggtttccgt
aatcgtcctgttaatatctatgaagtgcatgcaggttcatggaaacaacatgatgatggt
cgtccttatcaatttaaggaattaacagaagaattgattccttatttggttaagatgaat
tacacgcacgttgaattcatgccgttaatggcacatccgcttgggatgagttggggttat
caactaatggggtactttgctttcgagcatagttatggaacgccagaggatttccaaaat
ttcgttgaaacttgtcatttgaataatatcggtgtcattgtggattgggttccaggacat
tttacgattaatgatgatgctttggcttattttgatggaacgccaacgtttgagtacgag
gatgaagaccgagctcataaccgtggttggggcgctctaaattttgaccttggaaaaaat
caagttcagtctttcttaatttctagtgccaagttttggatagattattatcacttagat
ggtattcgagtggatgccgtaagtaacatgctgtatcgtgactatgatattggaccttgg
acaccaaataaagatggtggtaaccgtaattatgaggggtattatttcttacaaaaacta
aatgccgttttgaaaagcttttatcctgatatcatgatgattgctgaagaaagtaccagt
gacactaaaattacaggtcctattgaatacgatgcactcggctttgattataaatggaat
atgggatggatgaatgatattttgaaattctatgaagaagatcccatttatcgtaagtat
gattttaatcttgtcacatttagttttatgtatgctttttctgaaaactttatcctacca
ttctcacacgatgaagtggttcacggaaagaaaagcttgatgcataaaatgtggggtgac
cgttacaatcaatttgctgggcttcgtaatctttatacctatcaaatctgtcatccaggc
aaaaaattgctctttatgggaagtgaatttggtcaatttcttgaatggaaatatgactat
cagctagaatgggttaatttggaagatgacttaaacaagaaaatgcaagatttcacaagt
caactgaatgcattctacaaagagcacaatgtcttgtggcaaatagatgatagctatgac
ggtatcgaaatcattgatgcagacaatactgaccagaccgttctatccttcattcgtaaa
aacaaagatggcgatatgttaatttgtgtgtttaacatggtgcccgttgaacgtaaagac
tttacaattggagttccagttgcaggcatttacgaagaagtttggaatacagaaatggaa
gaatttggtggtgtctggaaagaacataatctccaagctcgcacacaagatagactttgg
aagaattaccatcatacgttaagtttcaccttacctgcactcggtgccagtatatggaaa
ataaaacgacgtttggcaaaacagattcctaagaaaggaaaatag

DBGET integrated database retrieval system