KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0854Help
Entry
SGGB_0854         CDS       T02018                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
sgt00010  Glycolysis / Gluconeogenesis
sgt00020  Citrate cycle (TCA cycle)
sgt00620  Pyruvate metabolism
sgt01100  Metabolic pathways
sgt01110  Biosynthesis of secondary metabolites
sgt01120  Microbial metabolism in diverse environments
sgt01130  Biosynthesis of antibiotics
sgt01200  Carbon metabolism
Module
sgt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGB_0854 (pdhC)
   00020 Citrate cycle (TCA cycle)
    SGGB_0854 (pdhC)
   00620 Pyruvate metabolism
    SGGB_0854 (pdhC)
Enzymes [BR:sgt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGGB_0854 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAK27733
UniProt: F5X0C2
Position
892992..894386
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEVIGYIGAEGETLVDSVGEKHVEQSASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDKGVD
LETLVGTGVSGKITKEDVLESLGDVAPQKEQADVKVTPQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPVVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggggaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccagcaggtgatgtcgtagctgttaccgaagttattggctatatcggagcagagggt
gaaactcttgttgattctgtgggtgagaaacatgttgaacagtcagcatcagctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagttggcacgtgagcgtggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacaaaggtgttgac
cttgagacactggtgggaacgggtgtttctggtaagattaccaaggaagatgttttagaa
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacaccgcaagca
ggagctttggctgatgttacggctgcaagtgacggcgttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaagggaatgagccattcttactttacagcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccttgcgtaagcaactcattgagcca
attatggcaaagactggttacaaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacaccgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcggctgaaatgtctggctca
acattcaccataacgaaccttgggatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaattcttggaatttcagcaactattgaaacacccgtcgttcatgac
ggtgaagtggttattcgcccaattatgggaatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttcttgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system