KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_0978Help
Entry
SGGB_0978         CDS       T02018                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGGB_0978 (pfkA)
   01230 Biosynthesis of amino acids
    SGGB_0978 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGB_0978 (pfkA)
   00030 Pentose phosphate pathway
    SGGB_0978 (pfkA)
   00051 Fructose and mannose metabolism
    SGGB_0978 (pfkA)
   00052 Galactose metabolism
    SGGB_0978 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SGGB_0978 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SGGB_0978 (pfkA)
Enzymes [BR:sgt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SGGB_0978 (pfkA)
Protein phosphatases and associated proteins [BR:sgt01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SGGB_0978 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014688..1015704
Genome map
AA seq 338 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAVRAVVRKAIKEGMEVFGINRGYAGMVEGDIFPLDAQSVSNT
LSHGGTFLQSARYPEFATLEGQLAGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GIPGTIDNDIAGTDYTIGFDTAVNTAMEALDKIRDTSFSHKRTFVVEVMGRNAGDIALWS
GIAAGADQIIIPEEEYDIKDVVAKVKDGYENKGKERHLIVLAEGVMHAEKFAELMKEAGD
TSDLRATNLGHILRGGAPSPRDRVLASWMGAHAVELLLEGRGGLAVGIHNEELVESPILG
TKEEGALFSLAEDGSIIVNMPHKARLDFAKLNRDIAHL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggcggcgacgctcctggtatgaatgctgctgtt
cgtgcagttgttcgtaaagcaattaaagaaggaatggaagttttcggaatcaaccgtggc
tatgctggtatggttgaaggcgatatctttccattggatgctcaaagtgtgtcaaatact
ttgtcacatggtggtacattccttcaatctgctcgttatcctgagtttgcaactcttgaa
ggacaattagcaggtatcgaacaacttaaaaaacacggtattgaaggtgtcgttgttatc
ggtggtgatggttcttatcatggtgctatgcgcttgactgaacatggtttcccagctgtc
ggtattccaggtacaattgataacgatatcgctggtacagattatactattgggtttgat
acagctgttaacacagctatggaagctcttgataaaatccgtgatacatcattcagtcac
aaacgtactttcgttgtcgaagtaatgggacgtaatgctggtgatatcgctctttggtct
ggtattgctgcaggtgctgaccaaatcatcatccctgaagaagaatacgacatcaaagac
gttgttgcaaaagttaaagatggttatgaaaacaaaggtaaagaacgtcaccttatcgtt
cttgctgaaggtgttatgcatgccgaaaaatttgctgaattgatgaaagaagctggagat
actagcgaccttcgtgctacaaaccttggtcacatccttcgtggtggtgctccatcacct
cgtgatcgtgttcttgcttcttggatgggtgcacacgccgttgaacttcttcttgaagga
cgtggtggacttgctgttggtatccacaacgaagaattggtagaaagcccaatccttgga
acaaaagaagaaggtgcattgttctcattggcagaagatggaagcattattgttaacatg
cctcacaaagcacgccttgactttgctaaattaaatcgtgacattgctcacttatag

DBGET integrated database retrieval system