KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1195Help
Entry
SGGB_1195         CDS       T02018                                 

Gene name
bglA3
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sgt00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1241147..1242652)
Genome map
AA seq 501 aa AA seqDB search
MTKAFPKNFLWGGAIAANQAEGAYNEDGRGLVATDVTTGGSVNAPRYMTYIDKDGKPGKA
PAMGHNGKIPEGAKYAVLDTEHYPNHVAVDFYHRYKEDIKLFAEMGYSVFRLSISWARIF
PNGDDKEPNQAGLDFYRSVFEECRKYNIEPLVSIWHFDTPLALEEKYGGWKNRKLIDFYV
RYCEVIFTEYKDLVKYWLTFNEINNTTMFLDMFGAKASDADYQDGYQILHHQFVASAKAV
QLGHAINPDFMIGNMICGITFYPGTCDPADILANEHKWESGIYYCGDVQAKGKYGTYAKR
LWKEHNVELDITAEDLEDLKRGTVDMYTFSYYMSNNVTTHTGVEEVAGNFSTGAKNPYLT
YSDWGWAHDPVGLQYYLEKIYDRYEIPLMVVENGLGAFDTVEDDGSIHDDYRIDYHRAHI
NAMADAIDNGVDLIGYTTWGCIDIVSAGTGEIRKRYGFIYVDMDDAGNGTLNRTPKDSFY
WYKDVLATNGQKAIEEAIQNH
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagcatttccaaaaaatttcctttggggcggagcgattgctgccaaccaagcc
gaaggagcttataacgaagatggtcgcggacttgttgcgactgatgtgacaacaggcggt
agtgttaatgcgccacgttacatgacttatattgataaagatggcaagcctggtaaagcg
ccagcaatgggacacaatggtaaaatcccagaaggtgctaaatatgcggtgcttgatacc
gaacattacccaaaccatgtagcggttgatttctaccaccgttataaagaagatattaaa
ttatttgctgaaatgggctattcagtctttcgcttgtctatttcttgggcacgtattttc
ccaaatggtgatgacaaagagcctaaccaagctgggctagatttttaccgttcagttttt
gaagaatgccgtaaatacaacattgagcctttggtgtctatttggcattttgacacgcca
cttgctcttgaagaaaaatacggtggttggaaaaatcgtaaactcattgatttttacgtg
cgctattgcgaagtgattttcactgaatacaaagatttggttaaatactggctaactttc
aatgaaatcaataatacgaccatgttccttgatatgtttggcgcaaaagcgagcgatgct
gattatcaagacggttatcaaattttacaccaccaatttgtagcgtcagctaaagctgtg
caactcggtcatgctatcaatcctgattttatgattggaaatatgatttgtgggattact
ttctatccaggaacttgtgacccagcagatattttggctaacgaacacaaatgggaatct
ggcatttattactgtggtgatgttcaagccaaaggaaaatacggcacatatgctaaacgc
ctttggaaagaacacaatgttgagttagacattacagcagaagacctcgaagatttgaaa
cgtggtactgttgacatgtacaccttctcatactatatgtcaaacaacgtgacgacacat
acaggtgttgaagaagtagcagggaatttctcaactggtgctaaaaatccttacttgaca
tactctgattggggttgggcacatgacccagtaggacttcaatattaccttgaaaaaatc
tacgaccgttacgaaattccattgatggttgtcgaaaatggtcttggtgcctttgatacg
gttgaagatgatggctcaatccatgatgactaccgtatcgattaccaccgtgcgcatatc
aatgccatggcagatgcaattgacaatggtgttgaccttatcggttacacaacttgggga
tgtatcgatattgtttcagcaggtactggtgaaattcgtaaacgctacggctttatctac
gttgatatggatgacgctgggaacggtacccttaaccgcacaccaaaagatagcttctat
tggtacaaagacgttctagcaacaaacggacaaaaagccattgaagaagcaatccaaaat
cattaa

DBGET integrated database retrieval system