KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1225Help
Entry
SGGB_1225         CDS       T02018                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgt00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270473..1271273)
Genome map
AA seq 266 aa AA seqDB search
MKIGKHEIDGTACIMGILNVTPDSFSDGGSYTSIENALAQAEKMIAAGAKIIDVGGESTR
PGYTFVEAEEEINRVVPVIRALKERFDVLVSIDTYKTETARAALEAGADILNDVWAGLYD
GKMLALAAEKNVPIILMHNQEEEKYDNITKEVCDFLTERAQAALDAGVALENIWIDPGFG
FAKNEAQNIELLKGLDAVCKLGYPVLFGISRKRTVDYLLGGGTLAADRDMGTAALSAWAI
AKGCQIVRVHNVDVNRDIVKVISQLS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaaaacacgagattgacggaacagcttgtatcatggggatacttaatgtg
accccagattctttttctgacggcggttcttacacttctattgaaaatgcccttgctcag
gctgaaaaaatgattgcagcaggagctaagattattgatgttggtggtgaatcaactcgc
ccaggctatactttcgttgaagcagaagaagaaattaatcgtgttgttcctgttatcaga
gcgctcaaagaacgttttgatgttttggtgagtattgatacatataaaactgaaacagca
cgggctgccttggaagcaggtgctgatattttaaacgacgtttgggctggtctttatgac
ggaaaaatgctggcgctggcagctgagaaaaatgttcctatcattttgatgcataatcaa
gaggaagaaaaatacgataatatcactaaagaagtttgtgattttttaacagaacgtgcc
caagctgctttggacgcaggcgttgcgcttgaaaatatttggattgacccagggtttggt
tttgctaaaaacgaggcacaaaatatcgaattgctaaaaggattagatgcggtttgtaag
ctcggttatccagttctttttggaatttcacgtaaacgtacggttgattatttgcttggt
gggggaacgttagctgccgaccgtgatatgggaacagctgctttatcagcttgggctatc
gcaaaaggttgccaaattgttcgtgtacataacgttgacgttaatcgtgacattgttaaa
gtgattagtcaactgagttga

DBGET integrated database retrieval system