KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1330Help
Entry
SGGB_1330         CDS       T02018                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SGGB_1330 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGGB_1330 (pyrB)
Enzymes [BR:sgt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SGGB_1330 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1373766..1374692)
Genome map
AA seq 308 aa AA seqDB search
MAVTDGVVSLKHLVTMETLSNEEVLGLIRRGIAFKTNKADFSLDRQYFAANLFFEPSTRT
HKSFEVAERKLGLDVIEFDAKTSSVNKGETLYDTILTMSSLGIDICVIRHSMEDYYKELI
DSRTIQTAIVNGGDGSGQHPSQCLLDLMTIYEEFGGFENLKVAIVGDITHSRVAKSNMQI
LKRLGAELYFAGPERWYSSEFDVYGKYVAIDDIVDKVDVMMMLRVQHERHDSERGFSKET
YHKIYGLTAERYEKMKASAIIMHPAPVNRDVEIADQLVEAPKSRIATQMQNGVFVRMAIL
EAVLNGKA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcagttacagatggcgttgtctcactaaaacatttagtgactatggaaacattatca
aacgaagaagtgcttggcttgattagacgtggtattgcgtttaaaacaaataaagcagat
tttagtttagatagacagtattttgcagcaaatcttttctttgaaccgtcaacacgtacg
cataagtcttttgaagttgctgaaaggaaacttggattggatgtcattgaatttgacgct
aaaacaagttcagtgaacaaaggcgagactttgtatgatactattttgacgatgagttct
ttgggaattgacatttgtgtgattcgccattcaatggaagattactacaaagaattaatt
gatagccgaacaattcaaacagcgattgtgaatggtggtgacggttcaggtcaacatcca
agtcaatgtttgttggatttaatgacaatttatgaagaatttggtggctttgagaatcta
aaagtagctatcgttggtgacatcacacattcacgtgtggcaaaatcaaacatgcaaatt
ctaaaacgtcttggagcggaattatattttgctggtccagaacgatggtattcaagtgaa
tttgatgtttatgggaaatacgttgcaatcgatgatattgttgataaggtggatgtcatg
atgatgcttcgtgttcaacatgaacgccatgatagcgaacgtggtttttcaaaagaaact
tatcataagatatatggtttaaccgctgagcgttatgaaaaaatgaaggcttctgcgatt
atcatgcaccctgcaccggtcaatcgtgatgtggaaattgcagatcaattggtagaagcg
cctaaatcacgaattgcaacacaaatgcaaaatggtgtttttgtgcgaatggcaattcta
gaagctgtgctgaacggcaaagcttaa

DBGET integrated database retrieval system