KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1512Help
Entry
SGGB_1512         CDS       T02018                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sgt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sgt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1571539..1572024
Genome map
AA seq 161 aa AA seqDB search
MTNLYDFTVKAQDGSDVQLSKYQGKILLIVNTATGCGLTPQYEGLQKLYDTYHDKGFEIL
DFPCNQFLNQAPGNADEINTFCTLNYQTTFPRFAKIKVNGKEADPLYDWLKSEQKGPLGK
RIEWNFAKFLIDQNGNVIKRFSSKTEPETIVTEIESLINDK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctttatgactttactgtcaaagcccaagacggctctgatgtccaattgtca
aaataccaaggcaaaatcctactcattgtcaatacggcaacaggttgtggcttaacccca
caatacgaaggactacaaaaactttatgacacttaccatgacaaaggatttgaaatttta
gattttccttgtaatcaatttttaaatcaagcgccaggaaacgccgacgaaatcaatacc
ttttgcaccttgaattaccagacaacttttcctcgctttgcgaaaattaaagtcaacggt
aaagaagccgacccactctatgattggctaaaaagtgaacaaaagggaccgcttggcaaa
cgtattgaatggaactttgcaaaatttcttatcgaccaaaatggcaatgtcatcaaacgt
ttttcatcaaaaacagaacctgaaacaattgttacagaaattgaaagccttatcaatgac
aaatag

DBGET integrated database retrieval system