KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1612Help
Entry
SGGB_1612         CDS       T02018                                 

Gene name
nagZ2
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SGGB_1612 (nagZ2)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SGGB_1612 (nagZ2)
Enzymes [BR:sgt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SGGB_1612 (nagZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1674439..1676115)
Genome map
AA seq 558 aa AA seqDB search
MVDLKAKPFYLDERAVQWVETTLNNMSLDEKLGQVFIQLAQPDKDYLDEKILGKHVGGIL
FRQNEAKVVQETLRYIQKSSKIPVLFCGNLEEGGIGLAKEGTYFSKQMETIATGNTDFAY
QNGRVLAREASALGCHMSFGPVVDMTIDWRSAITSTNTYGADADQVLKYASANMQGQMDN
GLVTAVKHFPGEGADDHDQHYNCEINEMSIAEWDNVFGKVFQGLIDQGTMSIMPGHIALP
SYQKYYADDMSGQVMPATYSKALLTNLLREKLGFNGLIVSDNTCIAGASNYLPRYQAVPQ
MLMAGIDLILYSFDMDEDLDYLKAALQDGRLTMERLNEAVTRNLAVKASLGLHDKQKEGT
LVPDEAALDVLGCVEHRDLARRCASDAVTLVKNGQNLLPLNTKEHQKILLTVISDPWERE
HVETLVKKQLEEAGFTVTVSNPNDSIPKDNSVRNWQKKYDLFLYISHQESARKDKLSLRI
NWHQAGNLPRFSADIPTVHISFGNPFELYDLPNIKTYINAYCLTDIVVEETLKKVLGQSD
FKGISPVDPFCGKDYLRY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatttaaaagcaaaaccattttatctggatgagcgtgctgttcagtgggttgaa
acaacattgaacaatatgtctttagatgaaaaattagggcaagtttttattcagctggca
caacccgataaagattatctggatgagaaaatccttggtaagcatgttggtgggattctt
tttcgccaaaatgaagcaaaagtggtacaagaaaccttgcgctacattcaaaaatcgtca
aaaattcctgtgctattttgcggtaatttagaagaaggtggtatcggtctagctaaggaa
gggacatatttttctaagcaaatggaaaccattgctactggcaatacggactttgcttat
caaaatggtcgtgtattagctagagaagctagtgctttaggatgtcatatgtcatttggt
ccagttgtggatatgactattgactggcgttcagccattacatcaacaaatacttatgga
gccgatgccgaccaagttttgaaatatgcttctgccaatatgcaagggcaaatggataat
ggtctggtaacagcggttaagcattttccaggggaaggtgcagatgaccatgaccaacat
tacaactgtgaaatcaatgagatgtctattgccgaatgggacaatgtttttggtaaggtg
tttcaaggtttgattgaccaaggcacaatgagtatcatgccaggacatatcgctcttcca
agctatcaaaaatattatgctgatgatatgagtgggcaagtgatgccagcgacatattct
aaagcattattgaccaatcttcttagggagaaacttgggtttaatggacttattgtcagt
gataacacttgtattgctggcgcaagcaattatcttccacgctatcaagcggtaccacag
atgttaatggcaggaattgacttaattctgtatagctttgatatggatgaggatttagat
tatctaaaagcagcactccaagatggtcgtttgactatggaacgcttgaacgaagctgtg
actagaaatcttgctgtcaaggcaagtttaggcttgcatgataagcaaaaggaaggaaca
ttagtgccagacgaagccgctttggatgttttgggctgtgtggaacaccgtgatttggca
agacgttgtgcaagtgatgctgtgacattagtgaaaaatgggcaaaatctcctcccccta
aacacaaaagagcatcaaaaaattttgttaaccgttatttcagatccatgggaacgtgaa
catgtcgaaactcttgttaagaagcagctagaagaagcagggtttacagtcacggtttca
aatcctaatgattctattcctaaggataatagtgtacgtaattggcagaaaaaatatgac
ttgttcctttatatttctcatcaggagtcagctcgaaaagataaattatctcttcggatt
aactggcatcaagcaggcaaccttccacgtttttctgcggatattccaaccgtacatatt
agttttggtaatccttttgaattgtatgacctaccaaatataaagacttatatcaatgct
tattgtttaacagacattgttgttgaagaaacattgaaaaaagttttaggtcagagcgat
tttaaagggattagtcctgtcgatcctttctgtggaaaagattatttacgatactaa

DBGET integrated database retrieval system