KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1830Help
Entry
SGGB_1830         CDS       T02018                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sgt01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sgt00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1879824..1881206)
Genome map
AA seq 460 aa AA seqDB search
MVVSDNNQLQKFENDDVAQYYFEILRQLIAKKSIFAQQIGLAEVANYLGDIFTEAGAEVT
IDDTCTAPFVLARFKSNRPDAQTIIFYNHYDTVPADDDQPWSSNPFELTIRDGYMYGRGV
DDDKGHITARLTAVQKYRREFGDFPVNIIFIMEGSEESASVGLETYLDKYANELRGADLL
VWEQGISNAKGQIEISGGTKGIVTFDMIVDSAKVDIHSKFGAVIESASWYLLNAIASLRD
ETGRILVDGIYDQVIEPSERELSLILEHANLDADNLKTLYGLNLPMLTRDKEKLVRTLFF
EPAITIEGISTGYQGQGVKTILPAKAQAKMEVRLVPGLEPKDVLQKIEQHLQQHGFEQVE
LVYTLGEKAYRSDMSAPAILNVIEIAKVFSPNGVSVLPTTAGTGPMHQFFEALEVPIASF
GIGNPDSRDHAGDENVNLADYYTHIEMIEELIKSYDKTDY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaagtgataataatcagttgcagaagtttgaaaatgatgacgttgctcaatat
tattttgagattttacgtcagttaattgctaaaaaatcgatttttgcacagcagattggg
ttagcagaagtagcaaattatctaggcgatatttttactgaagctggtgctgaagtgacg
attgatgatacttgtacggcgccgtttgttttggcacgttttaagagcaatagacctgat
gctcagacgattattttttacaaccattatgatactgtgccagctgatgatgaccagcct
tggtcgtcaaatccttttgaattaaccatccgtgatggctacatgtatggacgtggtgtt
gatgacgataaagggcatatcacagcacgcttgacagccgttcagaagtatcgccgtgag
tttggagattttccagttaacattatatttattatggaaggttcggaagaatcagcttct
gtgggtcttgaaacctatcttgacaaatacgctaatgagctccgtggcgcggatttattg
gtgtgggagcaaggtatttcaaatgccaaaggtcagattgaaatttctggtggaacaaaa
ggtattgtcacctttgatatgattgttgattctgctaaggttgatattcattcgaaattt
ggtgcggtcattgagtcagcatcatggtatttgcttaatgcgattgctagccttcgtgat
gaaactggtcgcattttggttgacgggatttatgaccaagtcattgagccaagtgagcgt
gagttgtcacttatcctagaacatgccaatcttgatgccgataacctaaaaacactatat
ggtttgaatttgccaatgttgacaagggataaggaaaagttagttcgaacgcttttcttt
gaaccagctatcacgattgagggaatttcaacaggatatcaaggtcaaggtgtcaaaacg
attctaccagctaaagctcaggctaaaatggaagttcgtttggttcctgggcttgaacca
aaagatgttcttcagaaaattgaacaacatttgcaacaacatggctttgaacaggtggag
ttggtttacacattgggcgaaaaggcatatcgtagtgatatgtctgccccggctattctc
aatgtgattgagattgcaaaggtattttcaccaaatggtgtttcagttttgccgacgact
gctggtactggaccaatgcaccaattctttgaagcattagaagttccgattgcttctttt
ggtattggcaatccagacagccgtgaccatgctggagatgaaaatgttaatttggcggat
tattacacccacattgaaatgattgaggagttgattaagagttatgacaaaaccgattat
taa

DBGET integrated database retrieval system