KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143: SGGB_1933Help
Entry
SGGB_1933         CDS       T02018                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sgt  Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sgt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1985602..1988082
Genome map
AA seq 826 aa AA seqDB search
MEYFFSGTIDRIIFENASNFFKILLLEIEDTDSDFDDFEIIVTGTIADIIEGENYTFWGE
LTQHPKYGEQLRVTRYERSKPTSSGLIKYFSSDHFKGIGKKTAEKIVQLYGDNTIDKILE
DPSKLDSISGLSKENKDNFLTKLKLNYGTELILSKLAEYGLTNRVAFEIFNQYKEDSLDI
IQENPYQLVEDIQGIGFKIADQLAEQLGIEADAPQRFRAALVHSLFETSIERGDTYVEAR
DLLENAITTLEEARQIELDPAAVAKELSTLIAEDKVQNVGTKIFDNTLFYAESGIKKHLT
RILDTPLDQNFSDGDLQEEIADVEEAFGISYDDVQKNAIKEALKSKVFILTGGPGTGKTT
VINGLIAAYADLHHIDLEKKDIPIILAAPTGRAARRMNELTGLPSATIHRHLGLNGDNDY
QAIDDYLDCDLIIIDEFSMVDTWLANQLFSSISSNTQVIIVGDSDQLPSVGPGQVLADLL
KIEALPQLALTKIFRQSEDSTIVTLANQMRLGKLPADFTQKKADRSYFEASAQYIPEMIP
KIVSAAVKSGIDPQEIQILAPMYRGAAGINRLNTIIQDLLNPLKDQLSFAFGEMNFRKGD
KVLHLINDAELNIFNGDIGYITDLIPAKYTESKQDELYMSFDGTEVIYPRNEWHKITLAY
AMSIHKSQGSEFQVVILPITRQSHRLLQRNLIYTAITRSKSKLVMLGEIAAFDYAIKNEG
AKRNTYLVQRFTSSAQEEESIDLQTEISQQTSPKTDNEAEKITSPTSPQTNISKEENIQL
TLDIAENEQTQTEQEPKIYRLTEENLAFINPMIGITQADIEQFFKK
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggaatacttcttttctggcacaattgaccgtattatttttgaaaatgccagtaatttc
tttaaaattttattactcgaaattgaggatactgattcagactttgatgattttgaaatc
attgttactggaacaattgctgatattatcgagggagaaaattatacgttttggggtgaa
ttaacgcaacacccaaaatatggcgaacagctcagagtcacacgttacgagcgcagcaaa
ccaacttcttccggtcttattaaatatttttcaagcgaccatttcaaaggaattggtaaa
aaaactgctgaaaaaattgtgcagctttacggcgacaataccattgataaaatcctagaa
gaccctagtaaattagacagtatttctgggctctctaaggaaaataaagacaacttttta
accaaactcaagcttaattatggtacagagctcattttatccaagttagcagagtatggc
ttgactaaccgcgttgcctttgaaatttttaatcaatacaaggaagacagtcttgatatt
atccaagaaaatccttatcaattggtcgaagacattcaagggattggttttaaaatcgct
gaccaactcgctgaacaattgggaatcgaagcggacgctcctcaacgttttcgtgctgct
ctcgtgcacagtctttttgaaacttctattgaacgaggagatacttacgtcgaagcgcgt
gatttgcttgaaaatgccattaccacccttgaagaagctagacaaattgagttagacccc
gcagccgttgccaaagaattatcaacgcttatcgctgaagataaggtgcaaaatgtcggt
accaaaatttttgacaatactcttttctatgctgaatcaggtatcaaaaaacacctgaca
cgtatccttgatacgccactcgaccaaaacttttcagatggtgacttgcaagaagaaatt
gctgacgttgaggaagctttcggcatttcttacgatgatgtgcaaaaaaatgctatcaaa
gaagcgctcaagagcaaggtgtttattttgactggtggtcctgggacgggaaaaacgact
gttatcaacggtttgattgctgcctacgcagaccttcatcacattgaccttgagaagaaa
gatattcctatcatcttagcagcgccaacaggacgtgctgcccgccgtatgaatgaatta
acaggcttgccaagtgcgactattcaccgccatttggggttaaatggtgataacgactac
caagctattgatgactatctcgactgtgacttgattatcattgatgaattttcaatggtt
gatacttggcttgccaatcaactctttagttccatttcgtccaatactcaagtcatcatc
gttggagatagtgaccaattgccgtctgtcggtcctgggcaagtattagctgatttatta
aaaattgaagctcttcctcaactagcattgactaaaatctttagacaatcggaagattca
accattgttacacttgctaatcagatgagacttggaaaattaccagctgacttcacacaa
aagaaagctgaccgttcttattttgaagcaagtgcacaatatatcccagaaatgattcct
aaaattgtcagcgcagctgttaagagtggcattgacccacaagaaatacaaatccttgcc
ccaatgtaccgtggcgcagctgggattaatcgacttaataccattattcaggatttactt
aacccacttaaagatcaactctcgtttgcctttggtgagatgaatttccgtaagggtgac
aaagttctccacctcatcaacgatgctgaactcaatattttcaatggtgatatcggctat
attacagaccttattcctgctaaatataccgaatccaaacaagacgaactttacatgtct
tttgacggcaccgaagttatctaccctcgtaatgaatggcataaaatcacccttgcttac
gccatgtcaatccacaaatcacaaggtagcgaatttcaggttgtcattttgccgatcact
cgccaaagtcaccgactcttacaacgtaacctcatttacacagctatcacccgctctaag
agtaaattagtgatgttaggggaaattgccgcctttgattacgccataaaaaacgaaggc
gctaagcgcaacacctatcttgttcaacgctttacaagctccgcacaagaagaagaaagt
attgatttacaaactgaaatttctcaacaaacatcacctaaaacagataatgaagctgag
aaaatcacctctccaacttctccccaaacaaatatttctaaagaagaaaacattcaactg
acactagatattgccgaaaatgagcaaacacaaacagagcaagaaccaaaaatctatcgc
ttgacagaagaaaacttggcatttatcaacccaatgattggcattacccaagccgacatt
gaacaattttttaagaaataa

DBGET integrated database retrieval system