KEGG   Syntrophobotulus glycolicus: Sgly_0190Help
Entry
Sgly_0190         CDS       T01429                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sgy00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201145..202053
Genome map
AA seq 302 aa AA seqDB search
MINEIEMTAYAKVNLALAVTSRRKDGYHNIQTIFQSISLSDMVKVRLVPEKGIRCDCGSL
SGEKNLAYGIAEKFLCSLNPEGRSKHLAETGIEITIDKHIPLEAGLGGGSSDAAAVLKAL
NLLYGKPLTEEGLLSIASQCGSDTAFCLAGGTQWGEGTGTELEPLPEMPPVEMIVVKPLA
GVNTGLAYQLFDEQAVWGKLDQADWRKALQGQDRREIGRLMQNSLEDVSIKIVSEIGEIK
KLLIKAGCIGALMSGSGSAVFGIVRDAEHGKFVKDILGEKGFSDSWLVRTIRNSEMVFRS
SS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgaaattgaaatgactgcctatgctaaagtaaatttagccttggccgttact
tcgcggagaaaagacggataccataatattcaaacgatttttcaaagcatcagtctgagt
gatatggtgaaggtaaggcttgttccggaaaaagggattagatgtgattgcggcagctta
agtggagaaaagaacttggcttatggaattgctgaaaaatttctttgttcactcaaccct
gaagggcgatcaaaacacttagcggaaacggggattgaaatcactattgacaagcatatt
cccctagaggccggtctgggtggcggcagcagtgatgccgcagctgtactgaaggcttta
aatctcctttatggaaagccgttgacggaggaaggactgctgagcatcgcttcgcaatgc
ggttcagatacggctttttgcttggctgggggtacccaatggggagaggggacgggaacc
gagcttgaaccgttgccggaaatgcctccggtagaaatgatcgtagtaaagcctttggcc
ggtgttaatactggtctggcctatcagttgtttgacgagcaggctgtttggggcaagctt
gatcaggcagattggagaaaggcattgcaggggcaagacagaagggaaataggcaggctg
atgcaaaattccctggaagatgtctcaattaaaattgtttcggaaataggggaaatcaaa
aaactcctgataaaggccggatgtataggagctttgatgtcaggaagcggttcggcggtc
tttggaatcgtccgtgatgccgaacatggcaaatttgtaaaagacattctgggcgaaaag
ggcttttctgattcctggctggtgcgaacaataaggaatagtgagatggtcttccgatca
agcagttaa

DBGET integrated database retrieval system