KEGG   Syntrophobotulus glycolicus: Sgly_0216Help
Entry
Sgly_0216         CDS       T01429                                 

Definition
dihydropteroate synthase (EC:2.5.1.15 4.1.2.25)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227167..228408
Genome map
AA seq 413 aa AA seqDB search
MKSEDHVKSPEPVKGTIINCRGQHLLLGNKTLIMGILNLTPDSFSDGGRFSKLEPALAQA
QKLIEEGADILDIGGESTRPGHTEISALEEWQRLEPVIRHLSVHSPVPLSVDTQKAEVAM
KALEAGAHIINDIWGLQKDPGMAEVAAYFAAPVIIMHNKEEAAYKDLWSEMQDFFHKSIE
IALKNGIQEEQIILDPGIGFGKTPAHNLEILSRLDELKNLGRPVLLGASRKSIIGKTLGL
PVEERLEPTIAISVLGAAAGIDILRVHDVRENKKAVMMADEIIRRKGDAVMKENNVIHLR
GMEFYGYHGVMPEEKITGQRFIVDMDIYPDVPLISGSDNIEFTVDYAEVYGVIKRCVEEE
KYNLLETLAEQIVKEVMKRFSCTKIRVEVHKPNAPIPGMIRDISVELKRERKQ
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcgaagatcatgtaaaaagcccggaaccggttaaagggacgatcatcaattgc
cgcgggcagcatcttctgttaggaaataaaacgttaatcatgggaatccttaatctgact
ccggattccttttccgatggaggccgtttttctaaactggagccggccctggcccaagcc
caaaagctgattgaagaaggagctgatattttagatatcggcggagaatcaaccagaccc
ggccatacggagatcagtgcgctggaagagtggcagaggctggaaccggttatcaggcat
ctgagtgtgcatagccctgttcccctttcggtggatacccagaaggcggaagtggcaatg
aaagcgcttgaggccggggctcatatcatcaatgatatctgggggctgcagaaggatccc
ggaatggcagaggttgcggcttattttgctgcaccggtgattatcatgcataataaggaa
gaggcggcttacaaagacctgtggagtgagatgcaggatttttttcacaaaagcatcgag
attgcgctaaagaacgggatacaggaagagcaaattattcttgatccggggattggcttc
ggcaaaacgcccgcgcataatcttgaaatattaagtcggctggatgaattgaaaaacctg
ggcaggccggttttattaggggcatcccgtaaatcgataatcggaaagactttgggcttg
ccggtagaagaaagattggaaccgacgattgcgatcagtgttctcggggcagcagccgga
atagatattcttcgggtacatgatgtcagagaaaataaaaaagcggtaatgatggcagat
gaaattatacgaagaaaaggagatgcggtcatgaaggagaataatgtcatccatctccgg
ggaatggagttctacggataccatggagtgatgcctgaagaaaagatcacaggccaaagg
ttcattgtcgatatggatatctatcctgatgtgccgctgatcagcggctcagacaacatc
gaatttacagttgattatgcagaagtatatggggtaatcaaaaggtgtgttgaggaagaa
aaatataatcttttggaaacattggctgagcagattgttaaggaagtcatgaagcgtttt
tcctgtacaaaaataagagtagaggtccataagccgaatgcccctataccgggtatgatc
agagatatttctgtagagcttaagcgggaaagaaagcaatga

DBGET integrated database retrieval system