KEGG   Syntrophobotulus glycolicus: Sgly_0217Help
Entry
Sgly_0217         CDS       T01429                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sgly_0217
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sgly_0217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
228405..228875
Genome map
AA seq 156 aa AA seqDB search
MRAFLGLGSNLGDRRSYLKKAVRMLKERSGITMIQESGVYESEPWGELGQNKFLNQVIEI
ETSSRPEELLSQCQKIEAALGRERSVHWGPRTIDIDLLLLENVRIDSAHLKIPHPYLEQR
NFVLIPLKEIAPNLVLPSGKVPSDYQEDEKIWRYRG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttttttgggattggggagcaatttgggagatcgaagaagctatctgaaaaaa
gcagtgagaatgcttaaagaacggtccgggatcacaatgattcaggaatccggagtttat
gaaagcgaaccatggggtgaactgggacagaataaatttctcaaccaggtgattgagatc
gaaacaagcagccgcccggaggaacttttaagtcaatgccagaaaatagaagcggcttta
ggcagggaaagatctgtgcattggggacccagaaccatcgatattgatctattgcttttg
gaaaatgtccgtattgattcggcgcatctgaaaattccccatccttatttggaacagaga
aattttgttctaattcctttaaaagagatcgctccgaatctggtcttgccatcaggcaaa
gtgccctcagattatcaagaggatgaaaaaatttggagatacagaggataa

DBGET integrated database retrieval system