KEGG   Syntrophobotulus glycolicus: Sgly_0279Help
Entry
Sgly_0279         CDS       T01429                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sgy00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:sgy02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(306690..308534)
Genome map
AA seq 614 aa AA seqDB search
MRKLSKTFFLILVSALLIGNLSAGGQAVAAEPAQAAPQAVIFPVDKASILAGSIFDLKVE
LNHIPSAPTEFDVRVQGTNAETFFNQTASTGATTKDGPYKMWKDVTFKAPAGNYTVSVSA
RGEGWTLSKEVQYNVVKAEAGKAKNVILVIGDGLALPMRTAARMVSKNLTEGKYNGLLEM
DNMDEVTLVTTSGLNSVVTDSANSAHAYATGHKTSNNAMGVYTFDPNDKNQVPPKVENII
ELAKKAGKATGIVSTAEITDATPSAMFVHVPQRSNMQEIANQMFYPAQRPDVILGGGAQW
FWPKSVAGSKRADERDLIGDFESQGYQFAGNAQELNNVDASKTNQLLGLFHNTTMNVYID
KAIEKNPNVLKNYPDQPMLWDMTQKSLDILSKNKNGFFLMVEGASIDKQEHVMDWERAVW
DTIEMDKAVGVAKDFADKNGDTLVIVVADHSHSVSVYGTVDYSKSGRDAVRVYEKAAWPT
YKDNDGDGFPDTGKDENGDGKFDQVVSTDISLAIGWGNHPDYIEDFKYSSVPISPAITVD
GKAAANTEGSAPGGYLIAGNLPVTDTQEVHSADDIPLTAYGTGSEYFDKAIMDNTEVFFG
IINALGLDPTKFSR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagctctcaaaaacgtttttccttatcctggtttcggccttgctgatcggcaac
ttgtctgccggcggacaggccgttgccgcggaaccggctcaggccgctccccaggcggtt
atctttcccgtcgataaggccagtattttggccggcagcattttcgacttaaaggtggaa
ctcaatcatattcccagtgctcccaccgaatttgatgtacgggtacaaggcacaaacgcg
gaaaccttctttaatcagacggcaagcacgggagccaccaccaaggatggcccgtataag
atgtggaaggatgttaccttcaaagcaccggccggcaattacacagtgtcggtcagtgcc
cggggtgaaggctggacgctttccaaagaagttcagtacaatgttgtaaaagctgaagcc
gggaaagcaaaaaatgttattttagtcattggcgatggcctggctcttcccatgagaacc
gccgccagaatggtgtctaagaatctcactgaaggcaaatacaacggcttgctggaaatg
gacaatatggatgaagtgacgcttgtgacaacctccggtctcaattctgtggtgaccgac
tcagccaacagcgcgcatgcttatgctacagggcataagacttccaataacgccatgggc
gtttacacttttgaccccaatgataagaaccaggttccccccaaggtggaaaacattatc
gaactggccaaaaaggcggggaaagccacaggaatcgtctccaccgcggaaattaccgac
gccaccccctccgccatgtttgtccacgttccccagcgttccaatatgcaggaaatagcc
aaccagatgttttatcctgcccaacgtcccgacgttattttgggcggtggagcccagtgg
ttctggcccaaatcggtagcaggctccaaacgggcggatgaaagagacttaatcggcgat
tttgaaagtcaaggctaccaatttgcaggaaacgctcaggaactgaataatgtcgatgcc
tctaaaaccaatcaattactgggcctgttccacaataccacgatgaacgtctatatcgat
aaggccattgagaaaaatcccaatgtcctgaaaaattatcccgatcagcccatgctctgg
gatatgacgcaaaaatccctggatattttgagcaaaaataagaacggatttttcctgatg
gtggaaggcgcctccatcgacaagcaggagcatgtgatggactgggaacgggccgtatgg
gataccatcgaaatggataaagccgtgggcgtggccaaagattttgccgacaaaaatggc
gatactctggtgattgtggtggcagaccattcccactccgtatctgtatatggcacggtt
gattacagcaaaagcggcagagatgccgtccgggtctatgaaaaagcagcctggcctact
tataaagataacgatggcgacggctttcctgacaccggtaaagatgaaaacggtgacggc
aaattcgatcaggtcgtatccaccgatatctcgcttgctatcggctggggcaaccatccc
gattatatagaagatttcaagtattcctccgtacctatctctcccgctatcaccgtggat
ggcaaagcggcggccaacacggaaggcagcgcacccggcggttatttaatagcggggaac
ctgccggtcacggacacccaggaagtacattcggctgacgatatccctttgacggcctat
ggcacggggtccgaatactttgacaaggcaattatggataatacagaggtatttttcgga
attatcaacgctttgggcctggatcccaccaaattcagcagataa

DBGET integrated database retrieval system