KEGG   Syntrophobotulus glycolicus: Sgly_0302Help
Entry
Sgly_0302         CDS       T01429                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Sgly_0302
Enzymes [BR:sgy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Sgly_0302
Amino acid related enzymes [BR:sgy01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Sgly_0302
Transfer RNA biogenesis [BR:sgy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Sgly_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
331570..333030
Genome map
AA seq 486 aa AA seqDB search
MTVKVRFAPSPTGPLHIGGARSALFNYLFSCNKKGKFILRFEDTDLERSSRESEKNIIQA
LRWLGIEWNEGMDKGGENGPYRQTERLETYQKYTNKLLAEGNAYYCYCSEEELDQERQEL
LMKGETPRYMGKCRSLTEAQKQVFESQGRKPVVRFRVPEGQEITINDSVRGKVTFDSNGI
GDYIIVKSDGIPTYNFAVVIDDVLMGITHVVRGEEHLSNTPRQVLIYEALNFDVPEFAHI
SLILNTEGHKMSKRDGDTAVIDYFQKGYLPEAMVNFIALLGWSPAGEKEFFTMEELKEEF
SLQRVSKSPAVFDVNKLNYINSHYLKEADLERLGCLALPFLQEEGLFVQDLSSEDQNWIR
IFLGAVREKISSLSEIKAYVQYFYGQIISEPDQEAASVLRGETVPQVLELFMEKITAAEK
LDPSRAKGILKEIGKELNLKGKDIFMPIRISLTGKMHGPDLDAIIALLGKDSIQARLAKT
KKYLLG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaaggtaagattcgcaccaagtcctaccggaccattacatattggcggggca
agatcggcgttatttaattatttattttcctgtaataagaagggaaagtttattctccgc
tttgaggataccgatctggaaagatcaagccgggagtctgagaaaaatattattcaggct
ctgcgctggttagggatagaatggaatgaaggaatggataagggcggagaaaacgggccc
tatcgccaaactgaacgattggaaacatatcagaagtatacgaataaattattagctgag
ggcaatgcatattattgttattgttcagaggaggaattggatcaggaaagacaagagctg
ctcatgaaaggggaaacaccccgttacatggggaaatgccgcagcctgaccgaagcacaa
aagcaggtgtttgagtcccagggacgtaaaccggtcgtgcgcttcagggtgccggaggga
caagagatcaccatcaatgattctgtccggggcaaggtcacctttgacagcaatgggata
ggcgattatatcattgtaaaatccgatgggattcctacttataattttgccgtagtcatc
gatgatgtattgatgggaattacacatgttgtccgcggcgaggagcatttatcaaacacc
ccgcgccaggtattgatctacgaagcactaaactttgatgtccctgaattcgctcatatc
tctttgatcttaaacactgaagggcataagatgagcaaaagagacggggatacggctgta
attgactatttccaaaaggggtatttgcctgaagcgatggtcaattttattgctttactt
gggtggtcccctgccggagaaaaagaattctttacgatggaagagcttaaagaagagttt
tccttgcaaagggtatcaaaaagtccggctgtattcgatgttaataagctgaattatatt
aattcccattatcttaaagaggccgatttagagagactgggttgtctggcattgcctttc
ttacaggaagaagggctgtttgttcaggatctctccagtgaggatcaaaactggatcagg
atattcctcggcgcggttcgggaaaaaatatcgtctttgagtgaaatcaaagcgtatgtc
caatacttctatggacagatcatctccgaaccggatcaggaagcggcctcggtactccgg
ggagaaacggtacctcaggttctcgagctttttatggaaaagatcacggcggcggagaag
cttgacccgtcaagggccaagggaatccttaaggagattggcaaagaactgaatttgaag
ggcaaagatatcttcatgccgatacgtatttcgttaacgggaaaaatgcacgggccagac
ctggatgcaatcattgctctcttgggaaaagacagcattcaggcgcgcttggcaaagaca
aagaaatatttgcttggttag

DBGET integrated database retrieval system