KEGG   Syntrophobotulus glycolicus: Sgly_0305Help
Entry
Sgly_0305         CDS       T01429                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sgly_0305
   00670 One carbon pool by folate
    Sgly_0305
Enzymes [BR:sgy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sgly_0305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
334949..335458
Genome map
AA seq 169 aa AA seqDB search
MKALVAVDLNWGIGYRGNLLKRIPEDMKLFKRLTLGKVVIMGRATFESLPGKEALKDRIN
IVLSKNDDYEKANVTVCHSLQELFPEIQKYSSEDIFIIGGETIYSQLLPFCSQAYITKIQ
NKYAADKYFPNIDQDRSWKLVSQSDLKIYEDIQFFFTEYVKIKEGENNG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcttgtcgcggttgatttaaactggggaattggatatcggggcaatctgctg
aaaagaatcccggaggacatgaaactttttaaaaggctgactttgggcaaggtggtcatt
atggggagggcgacctttgaatcattgccgggaaaagaggctcttaaagacagaatcaat
attgtgctcagtaaaaatgatgattatgaaaaggccaatgtaacagtatgccattcgtta
caggagttatttccggaaatacaaaagtatagctctgaggacatatttatcatcggcggg
gaaacaatatattcacaattgttgccattttgttcccaggcctatatcacaaaaatccag
aataaatatgctgctgacaagtattttcccaacattgaccaagaccggtcatggaaactt
gtttctcaaagtgatttaaaaatttatgaagatatacagtttttctttacggaatatgta
aagattaaagaaggtgagaataatggataa

DBGET integrated database retrieval system