KEGG   Syntrophobotulus glycolicus: Sgly_0675Help
Entry
Sgly_0675         CDS       T01429                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sgly_0675
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sgly_0675
Enzymes [BR:sgy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sgly_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
656652..657590
Genome map
AA seq 312 aa AA seqDB search
MKWMYKDLLDMDKLEGKEIELILETAVSMKEILGRPIKKLPTLRGKSVLLLFYESSTRTR
TSFETAAKILGADTGNIAVAQSSVTKGESLLDTARTLQAMNVDLVIVRHSGSGAAQFLAD
ELSASVINAGDGQHAHPTQALLDFLTMKEKLGGFQDRKIVIVGDILHSRVARSNAIGLKK
LGAEVVLVGPPTLLPPEMSYLGVQTSYDLDSVLEGADAVMALRLQLERQQSGLFPSLREY
RELYCLTPERLRKTGKETIIMHPGPMNRGVEIAGELADSPLSVIEEQVTNGVAVRMALIY
LLIGGGTNSVVD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggatgtataaggatcttctggatatggataagctggaaggaaaagaaattgaa
ctgattttggaaaccgctgtttccatgaaggaaatactgggacgcccgatcaaaaagctg
ccgacactccggggaaagtcggttttgctcttgttttatgaatcaagtacccgtacccgg
acatcttttgaaacagcggccaagatcctcggtgcggataccggaaatattgccgtggcc
cagagcagtgtgacaaaaggggaaagccttttggacacggcccggacccttcaggccatg
aatgttgatttggttattgtccggcattccggctccggggcggcccaatttctggccgat
gagctcagtgcttcggtaatcaatgccggcgacggccagcacgcgcatcccacccaggct
cttctggactttttgaccatgaaggaaaaattgggcggttttcaggacaggaaaattgtg
attgtcggggatattctgcattcccgggtggcccgcagcaatgccataggcttaaaaaag
ctgggtgctgaggttgttctggtgggaccgcctaccctcctgcccccggaaatgagctac
cttggggttcaaacctcctacgatttggacagtgtactggagggggcggatgccgtgatg
gccttgaggcttcagctggagcgccagcaaagcggcttgtttccgtcgctcagagaatac
cgggagctttattgcctcaccccggaaaggctgagaaaaaccggcaaggagacgattatt
atgcatcccggaccgatgaacagaggagtggaaatcgccggagaactggcggacagccct
ctttcagtgattgaagaacaggtcacaaacggagtagcagtgcggatggctttgatctat
ctgctgatcggagggggaacaaacagtgtggtggattaa

DBGET integrated database retrieval system