KEGG   Syntrophobotulus glycolicus: Sgly_0692Help
Entry
Sgly_0692         CDS       T01429                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00230  Purine metabolism
sgy01100  Metabolic pathways
Module
sgy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sgly_0692
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sgly_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_16 AAA_22 AAA_17 RNA_helicase Cytidylate_kin AAA AAA_30 ATPase_2 RsgA_GTPase NB-ARC ATP_bind_1
Motif
Other DBs
NCBI-ProteinID: ADY55054
UniProt: F0T0I9
Position
677013..677612
Genome map
AA seq 199 aa AA seqDB search
MGMLKNDQGILLVVSGPAGVGKGTLCRELMAQAGDLEYSVSVTTRAPRPKEQEGREYYFR
SREEFERMIEGRELLEWAEFCGNYYGTPLFHVQKVLAEGRTILLEIDIQGAKQVKQVFPQ
GVFIFIAPPSFETLSERLHKRGTEPEEVIQKRLKTAEGELRQIQAYDYIVENDRIDLAVE
KLRSIIIAEGCRVKNNLIV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgttgaagaatgatcagggtatccttcttgtggtttccgggcctgccggagtg
ggaaagggaacgctttgccgggagctgatggcccaggccggggatctggaatattcggta
tcggtgaccaccagggccccaagacccaaggaacaggaaggccgggaatattatttccgg
agcagagaagaatttgaacgaatgattgagggcagggagcttttggaatgggccgagttt
tgcggcaattattatgggacccccctttttcatgtccaaaaggtccttgccgagggaaga
accattcttctggaaatagatattcagggagccaagcaggttaaacaggttttccctcag
ggagtatttatttttattgcgccgccttcgtttgaaactctttcggaaagactccacaag
cggggcaccgaaccggaagaagtgattcaaaaaaggctgaagactgctgaaggggaatta
aggcagattcaggcatatgattatattgtggaaaatgaccggattgatttagctgtggaa
aagttacgaagtatcatcatcgctgaaggatgccgggtgaaaaataatcttattgtttga

DBGET integrated database retrieval system