KEGG   Syntrophobotulus glycolicus: Sgly_0709Help
Entry
Sgly_0709         CDS       T01429                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00010  Glycolysis / Gluconeogenesis
sgy00030  Pentose phosphate pathway
sgy00051  Fructose and mannose metabolism
sgy00052  Galactose metabolism
sgy00680  Methane metabolism
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01120  Microbial metabolism in diverse environments
sgy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_0709
   00030 Pentose phosphate pathway
    Sgly_0709
   00051 Fructose and mannose metabolism
    Sgly_0709
   00052 Galactose metabolism
    Sgly_0709
  Energy metabolism
   00680 Methane metabolism
    Sgly_0709
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sgly_0709
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Sgly_0709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase UPF0261 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADY55071
UniProt: F0T0K6
Position
693874..694956
Genome map
AA seq 360 aa AA seqDB search
MSEKIAVLTGGGDCPGLNAVIRAVVRSAHHKGLAVVGVRDGFKGAVEGDFFPLGLKDVSG
LLPRGGTILGTTNRDNPFSYFIEENGKKVQKDCSGQILKNFSDRGIDSLIAIGGDGSLAI
ASQLTEQGLRVIGVPKTIDNDLRATDLTFGFQTAVETARDALDKLHTTAESHHRVMILEV
MGRYAGWIALYAGIAGGADIILLPEIPYDLARVVQAIQDRVANHKKFSIIVAAEGARSQT
GEMVIERRQEDRPDPIRLGGIGAKVAGDLESLIDLETRVTVLGHLQRGGSPNAFDRILAT
RYGAAAVQAVLEKKFNTMVALKGQEITTVPLKEAIRELKRVDADNQVLLAARQIGIKFGD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaagatcgccgtactgaccggagggggagattgcccgggtctgaacgctgtg
atccgggcggtagtccggtccgcgcatcacaagggcctggctgtggtcggggtcagggat
ggctttaaaggagcagtggagggggatttttttccgctcgggctgaaagatgtatccggt
cttttgccgcgcgggggaacgattcttggcacgaccaaccgggacaatccattttcttat
ttcatagaggaaaacggtaaaaaggtccagaaagactgctccggccagattctgaaaaat
ttctccgaccgggggatcgacagtctgatcgcgatcgggggcgatggcagcttagcgatc
gcctcccagctgacggaacagggactccgggtcatcggggttcccaaaaccatcgacaat
gatcttcgggcaacggatttaacctttggttttcagacagcggtggagacggcccgggac
gctttggacaagctgcatacaacggcggaatcccaccacagggtcatgatcctggaggtc
atgggacgctatgcgggatggatcgccctttacgccggaatagcgggcggggcggacatt
attctgcttcctgaaatcccttatgatttggcaagggtggtgcaggctatacaagaccgg
gtggcaaaccataaaaaattcagtattattgtcgctgctgaaggggcgaggtcacaaacc
ggggaaatggttattgaacgcaggcaggaagaccgcccggacccgatcaggctgggcggt
atcggagctaaagtcgcgggcgatctggaatctctgattgacctggagacaagagtgact
gtactgggccacctgcagaggggaggttctcccaatgcgtttgaccgaatcctggctacc
cgttatggtgcggctgcggtgcaggcggtgctggagaaaaagttcaataccatggtggcc
ttaaaagggcaggagatcacaactgttcctttaaaagaggcgatcagggagctgaagcgg
gtggacgcggacaatcaggttctcctggcagcccggcaaatcgggatcaaattcggggac
tga

DBGET integrated database retrieval system