KEGG   Syntrophobotulus glycolicus: Sgly_0721Help
Entry
Sgly_0721         CDS       T01429                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00010  Glycolysis / Gluconeogenesis
sgy00052  Galactose metabolism
sgy00500  Starch and sucrose metabolism
sgy00520  Amino sugar and nucleotide sugar metabolism
sgy00521  Streptomycin biosynthesis
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01120  Microbial metabolism in diverse environments
sgy01130  Biosynthesis of antibiotics
sgy01200  Carbon metabolism
Module
sgy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_0721
   00052 Galactose metabolism
    Sgly_0721
   00500 Starch and sucrose metabolism
    Sgly_0721
   00520 Amino sugar and nucleotide sugar metabolism
    Sgly_0721
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sgly_0721
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sgly_0721
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sgly_0721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Pan_kinase gag_pre-integrs
Motif
Other DBs
NCBI-ProteinID: ADY55083
UniProt: F0T0L8
Position
706555..707541
Genome map
AA seq 328 aa AA seqDB search
MCMILTGDIGGTKTKFALFSWEDQQFKLIHQERVESKSISSLEDAVAGYLAGNHPGQSAG
IEAAWFSLAGPIAGNSCRLTNLDLTVDLRSLQKRLDFIPRVGWSNDLVAMGYGIAVLPED
ALLRLNGPGKQEDDRGEILNRAVLAPGTGLGEALMIGDQVYPTEGAHTDFAPHNEEDLEL
WRYLHRRYGHVSYERILSGAGLSNLYQFLRAQKKSPEQLPDQLPPEEISAKGLARSCPVC
TKALDMFVRLLGAEAGNLALKSLALGGVYLGGGIPPKIREKLTDGTLLAAFLDKGRFSRL
LKDIPVDVILEENTPLLGAAYLALQAQR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatgattttaaccggggatatcgggggcaccaaaacaaaattcgccttgttttca
tgggaggatcagcaatttaagctgattcaccaggaaagggttgagagcaaatcaatttct
tctctggaggacgcggtggcaggttatctcgcagggaatcatcccggacagtccgcgggg
attgaagcggcctggttcagtctggccgggccgatagcaggaaacagctgccggctgacc
aatcttgacctgaccgttgatctgcgttctttgcaaaagcggctggactttattccgagg
gtcggctggagcaatgatcttgtcgcgatgggctacgggattgctgttttgccggaggat
gccctgctcaggctgaacggcccgggaaaacaggaagacgacagaggtgagatcctgaac
agagctgttctggcgccggggacagggctgggggaagctctgatgatcggtgatcaggtt
tatccgacggaaggggcccatacggactttgctccccataatgaggaagacctggagtta
tggcggtatttgcacagacgctacggccatgtcagttatgagcggattctctcgggggca
ggcctgagcaatctctatcagtttttgcgggcgcaaaaaaagagccctgagcagcttccg
gatcagttgcctccggaggagatcagtgccaaggggctggctcgaagttgtcctgtctgt
acaaaggccctggatatgtttgtccgccttcttggggcggaggccggcaatctggctttg
aaatctctggctctgggcggggtctaccttggcgggggcataccgccgaagatcagggaa
aagctgacggatggcactttgctggctgcttttctggataaaggcaggttcagccgattg
ctcaaagatatccctgttgatgtgatcctggaggaaaacacgccgcttttgggggcggct
tatttggccctgcaggctcagagataa

DBGET integrated database retrieval system