KEGG   Syntrophobotulus glycolicus: Sgly_0866Help
Entry
Sgly_0866         CDS       T01429                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00010  Glycolysis / Gluconeogenesis
sgy00030  Pentose phosphate pathway
sgy00051  Fructose and mannose metabolism
sgy00052  Galactose metabolism
sgy00230  Purine metabolism
sgy00500  Starch and sucrose metabolism
sgy00520  Amino sugar and nucleotide sugar metabolism
sgy00521  Streptomycin biosynthesis
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01120  Microbial metabolism in diverse environments
sgy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_0866
   00030 Pentose phosphate pathway
    Sgly_0866
   00051 Fructose and mannose metabolism
    Sgly_0866
   00052 Galactose metabolism
    Sgly_0866
   00500 Starch and sucrose metabolism
    Sgly_0866
   00520 Amino sugar and nucleotide sugar metabolism
    Sgly_0866
  Nucleotide metabolism
   00230 Purine metabolism
    Sgly_0866
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sgly_0866
Enzymes [BR:sgy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Sgly_0866
    5.4.2.8  phosphomannomutase
     Sgly_0866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV DUF2218
Motif
Other DBs
NCBI-ProteinID: ADY55215
UniProt: F0T1V1
Position
845050..846447
Genome map
AA seq 465 aa AA seqDB search
MGTLNEQIFRQYDIRGVAERDLTDETVILLGKAFGTAAIQKGSYQVLLGRDNRLSSERLR
DALVKGLMAVGCDVLDIGLVVTPVLYYARFYYARLCLGIDAAVMITGSHNPPDENGFKLA
LGAGTIYGDEIQKLKELMLAGEFRYGSGSLEPVNCIPPYLKMLREKIQLGPRRLKVAVDC
GNGTAALFAEKILADWGCEVIPLYCQSDGSFPNHQPDPVKTANLAELKKAVLEEKADLGL
AFDGDADRIGVVDDAGKVIWGDVLMCLYWREIMPKYPGAKAIVEVKCSQALVDEVERLGG
KPFFYKTGHSLIKAKMKEIGAVFTGEMSGHIFFADEYYGFDDAFYAAGRLLRLLSHSDGP
LSKMLSAIPKYYSTAETRVTCPDWDKFKVVKGLAERFQRDYPVIDVDGARVLFGDGWGLV
RASNTQPVLVARCEAKTEEGLQRICSMMKEALREFPEVEDFEWEE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgctgaatgaacagatatttcgccagtatgatattcgaggggtggcggaaagg
gaccttacggatgagacggtaatcctcttagggaaagcttttggaacggcagcgatccaa
aagggctcctatcaagtcctgctggggagggacaaccgtctcagttccgaacgcttgcgg
gatgccctggtcaaggggctgatggccgtgggatgcgatgtgctggatatcggtctggtg
gtcacgccggtgctttactatgccaggttttactacgccaggctctgtctgggtattgat
gccgcggtgatgattaccggcagccacaatccgccggatgaaaacggattcaagctcgcc
ctgggcgccgggaccatttacggagatgagattcagaagctcaaagaattgatgctggcc
ggggagtttcggtacggttccggcagccttgaaccggtaaactgcattcccccgtatctg
aagatgctgagagaaaaaatacagcttggtccccgcaggctaaaggtagctgtggactgc
ggcaacgggacggcagccctgtttgccgaaaaaatattggcagactggggctgcgaggtg
atcccgctgtactgtcaatccgacggctccttcccgaaccaccagccggacccggtaaag
acggcgaacctggcagagctgaaaaaagcggtgctggaagagaaggccgatcttggcctg
gcctttgacggtgatgcggatcgcatcggggtggtggatgatgccggcaaggtgatctgg
ggagatgttctgatgtgtctttactggcgggaaatcatgcccaagtatcccggcgccaag
gccatcgtcgaagtgaagtgttcccaggctctggtggatgaggtggagcgtctcggcgga
aagcctttcttttacaagacaggccactccttgatcaaagccaagatgaaggaaatcggg
gccgtctttaccggggagatgtccgggcacatcttttttgccgacgaatattacgggttt
gacgacgctttttacgctgccggccgccttttgcggctcctctctcattccgatgggccg
ctctcaaagatgctctcggcaatccccaagtattattcgacggcggaaaccagggtcact
tgcccggactgggataaattcaaggttgtcaaggggctggctgagcgttttcagcgggac
tatcccgtaattgatgtggacggggcaagggtgctctttggggacgggtggggtctggtg
cgggcttccaatacccagccggtgctggtggcccgctgcgaggccaaaactgaagaagga
ttacagcggatttgctcgatgatgaaggaagccctgagggagttcccggaagtggaggac
tttgaatgggaggagtaa

DBGET integrated database retrieval system