KEGG   Syntrophobotulus glycolicus: Sgly_0958Help
Entry
Sgly_0958         CDS       T01429                                 

Definition
D-cysteine desulfhydrase family pyridoxal phosphate-dependent protein (EC:3.5.99.7)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sgy00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
944379..945377
Genome map
AA seq 332 aa AA seqDB search
MIKIPEKITLANLPTKIEKLERLSPKLGGPNIYIKRDDQTGTEVSGNKIRKLEFAVKEAL
DQGCDVLITCGGSQSNHCRATAAAAARIGIKSVLVLRGSSNEESDGNLFINRLLGAQIRF
ITPEEYRNKRAEIMEKIKAELEEQGRRPYIIPEGASNGIGSFGYYTAMAEIVRQEKELGV
HFDRIVIAAGSGGTYSGLFLASKTLGYTGQIYGINVCDDAEYFKNQIDKIVRESMQYINV
DLQFSKDEIHMIDGYVGQGYALSRPEEMHFIHEFARLEGIILDPVYTGKAMYGLAEEIKK
GNFKTCENILFIHTGGAFGLFPKKHLFTLPQV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaattcctgaaaaaataacgttggcaaacctgccaacaaaaatagaaaagttg
gaaagactttcgccaaaactgggaggaccaaatatctatatcaaaagagacgatcaaacg
ggaacggaggtttccggcaataaaataagaaagctggaatttgcggtcaaagaagcgctt
gatcaaggctgtgatgtgctcattacctgcgggggaagccagtccaatcactgcagagct
acggcagcggcagcggcaaggattggcataaaatcagttctcgttctaaggggaagcagc
aatgaagaatcagatggcaacttgtttatcaacaggcttttgggcgcgcaaatccgcttt
attactccggaagaatatcgaaataaacgggccgaaatcatggagaaaatcaaggctgaa
ctggaggagcagggccgcaggccttatattattccggaaggcgcgtctaatggaatcggc
agctttggatactatactgccatggcagaaattgttcgccaggaaaaggaactgggcgta
cattttgatagaattgtaatcgcggcagggtccggcggtacttattccgggcttttcctg
gcaagcaaaacactggggtacaccggtcaaatttatgggattaatgtttgcgatgacgcc
gaatacttcaaaaatcagattgataaaatagtgcgggaaagtatgcaatatatcaatgtg
gatttacagttttcaaaagatgaaattcacatgattgatggctatgtgggtcagggatat
gcactgagcaggccggaggagatgcactttattcatgaatttgccagactggaaggaatt
attctggaccctgtatatacgggtaaagcaatgtatggattggcagaggaaatcaaaaag
ggaaactttaaaacctgtgaaaacatcctgttcattcataccggaggagcgtttggcttg
ttccccaaaaaacatttatttacacttccccaggtgtaa

DBGET integrated database retrieval system