KEGG   Syntrophobotulus glycolicus: Sgly_0971Help
Entry
Sgly_0971         CDS       T01429                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sgly_0971
Enzymes [BR:sgy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Sgly_0971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
958396..959409
Genome map
AA seq 337 aa AA seqDB search
MNNYYITCGKREAQNDFPTHLISGIPSFLKAAILPPVESVLREHQVKAAVLGLPWEHTNT
CRPGASMGPRAVRNATDHYLSYHGEFQVDLFNALNLVDCGDVQIMPGNAKVTFERAEECL
LNIINAGAVPFVFGGDDSCPIPVTSAVSKTCQKGNIGYIHFDAHLDTAKDVGGELLNHAC
PVSRTAELPNCRGENVAIVGINGALNPPEEIDYCRENGIHVYSIWDIEERGVDTVIADII
EKVWAPGVEKVVLQTDLDCMDQAFVPGITTPETGGLTPREMLKFVRAFAKKGIAAYVIAE
CSPVYDPANISARVAVRLAMDAMGTIANPNGSGRISK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattattacatcacctgcggcaaaagggaagcgcagaacgattttcccactcat
ttgatctccgggattccctcctttttgaaggcggccatccttccgccggtggaaagtgtt
ctccgggaacaccaggtaaaggcagcggtactgggactgccctgggagcataccaataca
tgccggcccggggcttctatgggcccaagggcggtccgcaacgcaaccgatcattatctc
agctatcacggcgaatttcaggtcgatttattcaatgccctgaatctggtggactgcggt
gatgtccagatcatgcccggcaatgccaaggtgacgtttgaaagagcggaggagtgtttg
ctcaacatcatcaacgcgggtgctgtcccctttgtcttcggcggtgatgactcctgtccc
atcccggtgacctcggcggtttctaaaacctgtcaaaagggcaatatcggctacatccat
tttgacgcccacctggatacggccaaggatgtcgggggggaactgctcaaccacgcctgc
ccggtcagccggacggccgagctgcccaactgccgcggcgagaatgtggcgattgtcggg
atcaacggagcgctgaacccgcccgaggagattgactactgccgggagaacggcattcat
gtgtattcgatctgggatattgaggaacggggcgtggacacggtcattgccgatatcatt
gaaaaggtctgggctcccggtgtggaaaaggtcgtcctgcagacagacctggattgtatg
gaccaggccttcgtgccgggaatcacaacaccggaaaccggcggcctgacccccagagag
atgctcaaattcgtgagggcttttgccaaaaaaggaatcgcggcctatgtgatcgcggaa
tgcagcccagtgtacgatccggccaatatttcggcgagagtggccgtaagactggccatg
gacgcgatggggacaatcgccaatccgaacgggagcggcaggatcagcaagtag

DBGET integrated database retrieval system