KEGG   Syntrophobotulus glycolicus: Sgly_1399Help
Entry
Sgly_1399         CDS       T01429                                 

Definition
peroxiredoxin (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sgly_1399
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sgly_1399
Enzymes [BR:sgy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sgly_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1400872..1401414
Genome map
AA seq 180 aa AA seqDB search
MSVYDYEYTSIENRPVQMSEYQGQVVLIVNTASKCGFTPQYKGLEELYRRYRDQGFTVIG
FPCNQFMEQEKGSNEQISEFCSVRYGVTFPLSQKVDVRGETAIPLYQYLTSQKGFEGLGK
GIKAKALELTLKARYKDGFADEQIKWNFTKFLIDRNGKVVSRYEPIVEPKDIASDIEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttatgattacgaatacacatcaattgagaatcgcccggtgcaaatgtccgag
tatcagggacaagtagtgctcattgtcaacacagccagcaaatgcggcttcaccccgcag
tacaaggggcttgaagagctttaccggcgttacagggatcagggctttacggtcatcggc
tttccctgcaaccagtttatggagcaagaaaaaggaagcaatgagcaaatctccgagttt
tgttcggtgcgctacggtgtgaccttccctttgtcgcaaaaggtggatgtacgcggggaa
accgccataccgctctatcaatatttgacctcccaaaaaggctttgaagggctgggcaag
gggatcaaggccaaggcgctggagcttacgctcaaggccagatacaaggacggttttgcg
gacgagcaaatcaaatggaactttaccaaatttctgattgaccggaacggaaaggtggtt
tcccgttacgagccgattgtcgaacccaaggacattgcctccgacattgaaaaattactg
taa

DBGET integrated database retrieval system