KEGG   Syntrophobotulus glycolicus: Sgly_1635Help
Entry
Sgly_1635         CDS       T01429                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sgly_1635
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_1635
  Lipid metabolism
   00071 Fatty acid degradation
    Sgly_1635
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sgly_1635
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sgly_1635
   00626 Naphthalene degradation
    Sgly_1635
Enzymes [BR:sgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sgly_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1667526..1668704
Genome map
AA seq 392 aa AA seqDB search
MKFNYNMPTKILFGPGKLNSLKKEKLPGKKALIVISAGNSMKSNGYLDRVIEILNSKGIK
AVIFDQILPNPVKAHVMEGAKIAVREECDFVIGLGGGSSIDSAKSIAVMAKNPGDYWDYI
SGGTGKGKPVENGALPVVAITTTAGTGTEADPWTVITKEDTKEKIGFGNADTFPVLSVVD
PELMLTVPKKLTAYQGFDAFFHATEGYIAKIANPFSDLYALKSIELIARYLPRAVKDGND
LEARTQVALANTLSGFVESTSSCTSEHSMEHALSAYYPDLPHGAGLIMLSEAYYTFFASK
VPERFISMAEAMGVNVDLLPENERPMAFVQALVKLQQDCEVDGLKMSDYGIKREEITLLA
DHARETMGGLFTVDPYSLSLEETTEIMKNAYK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttaattataatatgccaactaaaattttgtttggccccggaaagctgaatagc
ttgaaaaaagagaagcttcccgggaaaaaagcattaatcgtcatctcggcagggaattcc
atgaaaagcaacggatacttggacagggtcatcgaaattctcaattccaagggaatcaaa
gctgtaatctttgatcaaatcctccccaatcccgtaaaagctcatgtcatggaaggagca
aagatcgctgttcgggaagaatgtgattttgtgattggtcttggcggcgggagcagcatc
gattcggcaaagagcattgcggtaatggcaaagaatcctggtgactactgggattacatc
agcggaggaacaggaaaaggaaagcctgttgaaaacggagcgctgccggtagtggccatt
acaactaccgccggtaccggaacagaagctgacccatggactgtaattacaaaagaagac
acgaaggaaaaaattggttttggaaatgcggatactttcccggtattatctgtagttgac
cctgagctaatgctgaccgtaccgaagaagcttaccgcttatcagggatttgacgcgttt
tttcatgcgacggaaggttatattgccaaaatagcaaatccgttcagtgatctctatgcg
ttaaagagtatcgagcttattgcccggtacctgccgcgagcggttaaagacggcaacgat
cttgaagcacggacacaggttgctttggccaacactctttcaggctttgtcgagtctact
tccagctgtacatccgaacattccatggaacatgctttaagtgcctattaccctgatctt
ccgcatggagcaggactgatcatgttgtctgaggcgtattatacgttctttgcctccaaa
gttcctgaacggtttatttctatggctgaagcaatgggagtgaatgttgatcttcttcct
gaaaacgagcggccaatggcttttgttcaggccctggtcaaacttcagcaagattgtgaa
gttgacgggctgaaaatgtccgattatgggataaaaagggaggaaataaccttgctggcc
gatcatgccagagagacaatgggcgggctgtttactgttgatccatacagcctgtcgctg
gaagagacaacggaaatcatgaaaaacgcttataaatag

DBGET integrated database retrieval system