KEGG   Syntrophobotulus glycolicus: Sgly_1782Help
Entry
Sgly_1782         CDS       T01429                                 

Definition
(GenBank) Cellulase
Organism
sgy  Syntrophobotulus glycolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1808095..1809141)
Genome map
AA seq 348 aa AA seqDB search
MLLKELCSLSGVSGDETAVRNYLQDYLKDVVDSLSVDKMGNLIAVKNGTSTSAPTILLSA
HMDEVGFMITDITADGYLKFEPIGGIDERILISKPVLINRKTYGVIGIKAIHLQKMDERR
KVFTSEQLYIDIGAGSKEDAEKAVSLGDYACFASDYFDHEDSISAKSLDDRAGCSIIARI
LQDRYDCTIMAVFTVQEEIGLRGSKVISNWVKADLALLLESTGAADFLSIEEEDWVVSLG
KGPALSIMDQTTIYDRGLFHHLIKTAEHHAIPYQIRQGTQAGNDSGNIHLAGEGIRTMAV
SIPCRYIHAANSMINKNDYENCYALIHQFLQNIKNNNWEESECAKKSL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcttttaaaagaattatgttctctttccggggtgtccggtgatgaaacagcagtccgc
aattatctccaagactatctgaaagatgttgttgattccttgtctgtcgataaaatgggc
aatttgattgctgtcaaaaacggtacatcaacatctgcccccacgattttattgtccgct
catatggatgaagtcggttttatgatcaccgacatcactgccgatggctatttgaaattc
gaaccgatcggaggaatagatgaacggatcttaatctccaaaccggttctgatcaaccgc
aaaacatacggagtgatcgggattaaggcgattcatctccaaaaaatggatgaacgcaga
aaggtcttcacttcagaacagctctatatcgacattggagccggatcaaaagaagatgct
gaaaaagccgtcagcctgggagattatgcctgctttgcctctgattatttcgatcatgag
gacagcatttcagcaaaatctctggatgacagggcaggttgctcaattattgcccgaatc
ttacaagatcgttatgactgcacgattatggctgtttttaccgttcaggaagagatcggc
ttgcgcgggtccaaagtgatcagcaactgggtaaaggctgatctggccctgttgcttgaa
agcacgggagcggcagatttcttaagtatagaagaagaggattgggttgtcagcctgggc
aaaggtccggctttatccatcatggaccagacaacgatttatgaccggggattatttcac
catttgatcaagacggcagagcaccatgctatcccttatcagatccggcagggaacacaa
gccggcaacgactcgggcaatatccatctggccggtgaagggatcagaacaatggccgtc
agcattccctgccggtatatccatgcggctaactcaatgatcaataaaaatgactacgaa
aattgttatgctttaatccatcaatttcttcagaacatcaaaaacaataactgggaggaa
tctgaatgcgcgaaaaaatcactttag

DBGET integrated database retrieval system