KEGG   Syntrophobotulus glycolicus: Sgly_1843Help
Entry
Sgly_1843         CDS       T01429                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sgly_1843
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sgly_1843
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sgly_1843
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sgly_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1873724..1874905
Genome map
AA seq 393 aa AA seqDB search
MSNEGFYGEYGGSFVPPELKNVLQTLADTFEKFKGNPEFNEELDYYLREYVGRPNPLYLA
EKLSHQLGGAKIYLKREDLNHTGAHKINNTIGQVLLAKRMGLKRIIAETGAGQHGVATAT
ACALFDLDCIIYMGEEDTKRQALNVFRMELLGAKVVPVTRGTKTLKDAVDAALEDLVMNH
QDTFYMLGSAVGPHPYPAIVKHFQAVISREARRQVLAKEGRLPDAVLACVGGGSNAIGIF
ADFIPDQSVRLIGVEPAGYGIETGKHAAPISAGKPGIIHGFKCYLMSDEQGEPLPTHSIS
AGLDYPGVGPEHSYLHDTGRAEYVHITDMEALDAFHTLSKVEGIIPALESSHAVAYAMKL
APTMSKDSILIVNLSGRGDKDVQQIFEMMRDKQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccaatgagggtttttatggtgaatatggcggaagctttgttccccccgaattaaaa
aacgtccttcagacgctggccgatacatttgaaaaatttaaaggcaatcctgaattcaat
gaagagctggattattatctccgggaatatgtcggtcgtcccaatcctctgtatttggcg
gaaaagctttcccatcagctcggcggggcaaaaatataccttaaacgtgaagatttgaac
cataccggagcccataagatcaataacacgatcggtcaggttcttttagccaaacggatg
ggcttgaaaaggatcattgctgaaaccggagccggtcagcatggagttgcaaccgcaact
gcctgtgcgctttttgatctggactgtattatttatatgggtgaagaagataccaaacgc
caggccttaaatgttttccgtatggaacttttgggggcgaaggttgttcccgtgaccaga
ggaacaaaaacactgaaggatgcggtagatgccgctctggaagatttggtcatgaatcat
caggataccttttatatgcttggttcggctgtcggccctcatccttatcccgctattgtg
aagcattttcaggcggtgatcagccgtgaagcccgccggcaggttttagccaaagaaggc
cgcctgcctgatgccgttctggcttgtgtcggcggcggcagtaatgccatcggtattttc
gccgattttatcccggatcaatctgtccgcctgattggggttgaaccggccggctatggc
attgaaaccggaaaacacgccgctccgataagcgcaggtaaacccggaattattcatggt
ttcaaatgttacctgatgagtgatgaacaaggtgagcccctccccacccattctatttcc
gcgggactggattatcccggagtcggtcctgaacatagctatctgcacgataccgggcgc
gccgaatatgtccatattacggatatggaagccttggacgctttccatacactgtctaag
gtggaagggatcattcccgcgctggaaagctcccacgctgttgcctatgccatgaaactt
gctccaaccatgagcaaggactccattttgatcgttaacctctcgggacgcggggataag
gatgtgcagcagatttttgaaatgatgcgggataagcaatga

DBGET integrated database retrieval system