KEGG   Syntrophobotulus glycolicus: Sgly_1846Help
Entry
Sgly_1846         CDS       T01429                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sgy00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1877355..1879205
Genome map
AA seq 616 aa AA seqDB search
MCGIAGWIDWENDLRSSAQVMEKMVDTMVPRGPDARGIWLDEHIIFGHSRLAVVDIEGGK
QPMLRKKHDCSYLITYNGELYNTEDIRKELKECGYTFQGHSDTEVLLLSYIEWGTDCVQK
LNGIFAFGIWDTKNQSLFLARDRIGVKPLFYTVQDGSLIFASELKALLAHPKVPAKIDLE
GLAEVFLIGPARTPGFGVFKNIAEIRPGWSVFYTRDGLTTRQYWQLQGSLHQDDFDTTVE
KVRTLVIDAVKRQLVSDVPIGALLSGGLDSSIITAIAAESFRKENKGCLPTFSIDYVGNK
EHFKANAFQPDPDAPWVEKMEKAFRTNHRYFYLETDDLVKALEDAVMARDLPGMADIDSS
LLLFSRKIKHNVTVGLSGECADEVFGGYPWFHRQEALRAETFPWAMFPETRLHVMAEELI
AKINPQEYINARYSAALKEVPAGPDELSPAEDNLRKIGYLTLTRFMPTLLDRKDRMTMAT
GLEVRVPFCDHHIVDYVWNIPWQIKNYKGREKGLLRMAAQGILPEDVLWRRKSPYPKTHH
PGFLKAVSSKLQDIINDPSSPLLPFINKNHVLDLLANPISTANKPWFGQLMDTPRVFAYL
IQMDFWFRHYGISVET
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgccggctggatagattgggaaaatgatttgcgctcctcggcacaggtc
atggaaaaaatggtggatacgatggtgccaagaggaccggatgcccgaggaatatggctt
gatgaacatattattttcggtcatagccgccttgccgttgtcgacattgaaggcggcaaa
caaccgatgctcagaaagaaacacgattgctcatatctcatcacctacaatggtgagctc
tataatactgaagatattcgcaaagagttaaaagaatgcggctatacttttcagggtcac
tcagatacagaagttcttctgctctcttacatagaatggggtactgactgtgtgcaaaaa
ttaaacggtatttttgcttttggcatttgggacacgaagaaccagtctttatttttggcc
cgggacagaatcggagttaaaccattattctataccgttcaggatgggtcgttgatcttc
gcctctgaacttaaggctcttcttgctcatcccaaagttcccgccaaaatagatctggaa
ggattggcggaagtgtttttgattgggccggcccggacaccgggatttggggttttcaaa
aacattgccgaaatcaggcccggctggtccgtattctataccagagacggcctgacaacc
cgtcaatactggcagttacagggaagtctccatcaggatgatttcgatacaacagtagag
aaagtccggacactggttattgatgccgtaaaaagacagttggtttccgatgttcctatt
ggagcactgctttccggaggtttggattcgagtatcattactgctattgccgcggaatcg
tttcggaaggaaaataaaggctgtcttcccactttttctattgattatgtcgggaacaaa
gagcattttaaagcgaatgcttttcagcccgatcctgatgcgccctgggttgaaaaaatg
gaaaaagctttccgcaccaatcatcgttatttttatctcgaaaccgatgatttggtcaaa
gccttagaggacgccgtgatggccagggaccttccgggaatggctgatatagactcttcc
ctcctgctcttcagccggaaaatcaagcacaatgtcaccgtcggtttatccggtgaatgt
gcggatgaagtatttggaggatatccctggttccacagacaggaagcgcttcgcgcggaa
acattcccctgggcgatgttcccggaaacaagacttcatgtaatggcggaagaactgatc
gccaaaataaaccctcaggaatatatcaatgccagatattccgcagcgctcaaggaagtc
ccggcaggaccggatgagctgtctcccgcggaagataacttaagaaaaatcggttatctg
actttaaccagatttatgccgacgcttctggaccggaaagacagaatgaccatggctacc
ggtttggaagtccgtgtgccgttctgtgatcatcatattgttgactatgtatggaatatc
ccctggcagatcaaaaactacaaagggcgggaaaaaggtcttcttaggatggcagcccag
ggaattttgcctgaagatgtgttatggagacgcaagagcccctatccaaaaacgcatcat
ccgggattcctgaaggccgtaagctcaaaattacaggatatcattaatgatccttcttct
cctcttttgccgttcattaataaaaaccatgtccttgatcttcttgccaacccgataagc
acggccaataaaccctggttcggccagcttatggatacgccccgcgttttcgcctacctt
attcaaatggatttttggttcagacactatgggatcagtgtggagacataa

DBGET integrated database retrieval system