KEGG   Syntrophobotulus glycolicus: Sgly_1967Help
Entry
Sgly_1967         CDS       T01429                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sgly_1967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sgly_1967
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sgly_1967
Enzymes [BR:sgy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sgly_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1980276..1981763)
Genome map
AA seq 495 aa AA seqDB search
MYESTRGNFSTKSAAEVIALGMVPQGGLFVPTALPKARWQDYQNSTYSQLAAALMNLFLT
DIPSADIEKAVKVYEDGRFSSANPVPLVGLADCSVLELWHGPTAAFKDMALQVLPYLLSS
SIKTLGTEQEVIILTATSGDTGKAALEGFKDVPGTRIIVFYPEGGVSPVQERQMLTTKAQ
NTTVVAVKGNFDQCQNAVKDIFSSEQLRNELLEHKMVFSSANSINWGRLLPQIVYYFWAY
IQAFKQGKIKENEKLNIVVPTGNFGNILAAYYAREMGLPIANLICASNDNKVLADFFQTG
IYDSNRPFYLTSSPSMDILISSNFERYLYEASGRNGKKVRQWYEQLASSGRFEVDREVLT
ACRDGMWAGWCDQQAVKSTIKKVYADSSYLLDSHTAVAMKVYQDYREKTGDPAFTVIVST
ASPFKFAQSVLEALTEKSFSGKAGEAVERLKDTTGWEIPDCLENLFEKAIREKILCSPEE
INGLITNDLLKKKFL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgaaagtacgcggggaaatttttcaactaaaagtgccgctgaagtgattgccttg
ggcatggtgccacagggagggctttttgtcccgacagctctgcccaaggccagatggcag
gattatcagaacagcacatactctcaattggcagcagccttgatgaatctgtttttaacg
gatattccctcagcagatatcgaaaaagcagtaaaggtatatgaagacggcaggttttca
tctgctaatcccgtcccgcttgtcggattggcggattgttccgtcctcgagctttggcat
ggcccgacagcagcctttaaagacatggcccttcaggttttaccttatctgttgtcttcc
agtatcaaaacacttggcacagaacaagaagtaattattctgacggctacttcgggagat
acgggcaaggcggccctggaaggcttcaaagacgtcccggggacaaggatcattgttttc
tacccggaaggcggtgtcagtccggtccaggaaagacaaatgctgaccacaaaggcgcaa
aatacaacagtagtggctgttaaagggaactttgaccagtgccagaatgccgttaaagat
attttttcctcagaacagctgagaaatgagttattggagcataaaatggttttctcttcg
gccaattccataaactggggaagattgctgccgcaaattgtttactatttttgggcttat
attcaggcgttcaaacaaggcaaaatcaaagaaaacgaaaaactcaatattgttgtgcct
accgggaacttcggcaatatcctggcagcttattatgcccgggaaatggggctgccaatc
gccaatctgatttgcgcttccaatgacaataaagttttggctgattttttccaaacaggg
atttacgacagcaacaggccattctatttgaccagttcaccctctatggatatcttaata
tcaagtaattttgaaagatacctctacgaggcatccggaagaaacgggaaaaaggtcagg
caatggtatgaacagttagcttcatccggcaggttcgaggtggacagggaggttttgacc
gcctgcagagacgggatgtgggccggatggtgcgaccagcaggctgtaaaaagtacgata
aaaaaggtttatgcagattcttcttatttgcttgattcccataccgcagtggcgatgaaa
gtgtaccaggactatcgagaaaagaccggagatcccgcttttactgtgattgtttccacg
gccagtccttttaaatttgcgcaaagcgttttggaagccctgacggaaaaaagttttagc
gggaaagccggggaggcggttgagcggttgaaggatacgaccggatgggaaataccggat
tgtttggagaatttgtttgaaaaagcaatcagggaaaagatattgtgctcaccggaagaa
atcaacggcttgattacaaatgatctgttgaaaaagaaatttttataa

DBGET integrated database retrieval system