KEGG   Syntrophobotulus glycolicus: Sgly_2065Help
Entry
Sgly_2065         CDS       T01429                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sgly_2065
Enzymes [BR:sgy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sgly_2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2082160..2082726)
Genome map
AA seq 188 aa AA seqDB search
MEINTQKLEQAVSMLLEAIGEDPEREGLIDTPKRVAKFYAEAFAGLHDDPSKHLQVIFDE
NHEEMVIVKDIPMYSMCEHHLLPFFGKAHVAYIPRNGKVTGLSKLARVIDGYARRPQLQE
RLTTQIADTIKNSLEARGVLVVIEAEHMCMTLRGIKKPGSKTVTSAVRGIFQTSSATRAE
AFSLIMGK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaatactcagaagctggaacaggcggtaagtatgctgctcgaagcaattggt
gaagaccctgaacgagaaggattgatcgatacaccgaaaagagtagcgaagttttatgcg
gaagcttttgcgggcttgcatgatgatccaagtaagcacctgcaagtgatttttgatgaa
aaccatgaagagatggtcattgtcaaggatatcccgatgtattccatgtgtgaacatcat
ttgcttccttttttcggaaaggctcatgtcgcgtatatcccgcgcaacggtaaagtgaca
gggttatccaagctggccagagtgattgacggctatgcccgcaggccccagcttcaggaa
aggttgacaacccagattgccgataccataaagaattctttggaagccaggggtgttctg
gtggtcattgaggctgaacatatgtgtatgaccttacggggaattaaaaagcccggctcc
aaaacagtaacctcagcagtaagaggaatatttcaaacaagctcggcaaccagagcggaa
gctttttctctgatcatgggaaaataa

DBGET integrated database retrieval system