KEGG   Syntrophobotulus glycolicus: Sgly_2073Help
Entry
Sgly_2073         CDS       T01429                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sgy  Syntrophobotulus glycolicus
Pathway
sgy00010  Glycolysis / Gluconeogenesis
sgy00030  Pentose phosphate pathway
sgy00051  Fructose and mannose metabolism
sgy00052  Galactose metabolism
sgy00680  Methane metabolism
sgy01100  Metabolic pathways
sgy01110  Biosynthesis of secondary metabolites
sgy01120  Microbial metabolism in diverse environments
sgy01130  Biosynthesis of antibiotics
sgy01200  Carbon metabolism
sgy01230  Biosynthesis of amino acids
sgy03018  RNA degradation
Module
sgy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sgy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sgly_2073
   00030 Pentose phosphate pathway
    Sgly_2073
   00051 Fructose and mannose metabolism
    Sgly_2073
   00052 Galactose metabolism
    Sgly_2073
  Energy metabolism
   00680 Methane metabolism
    Sgly_2073
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sgly_2073
Enzymes [BR:sgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sgly_2073
Protein phosphatases and associated proteins [BR:sgy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sgly_2073
Messenger RNA biogenesis [BR:sgy03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sgly_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADY56366
UniProt: F0T222
Position
complement(2090166..2091134)
Genome map
AA seq 322 aa AA seqDB search
MRAVDKVAVLTSGGDAPGMNAAIRAVVRKGIFHNLRIFGVYHGFAGLINGQITQMELGSV
ADIVHRGGTILKTARCKEMLLPEGQKLAADQLIARGIDALVAIGGDGTYRGAKKLAELGI
KVVGIPGTIDNDINGTDFTIGFDTSVNTVVEAVSKLRDTATSHERVFVVEVMGRNCGDIA
LHAGLATGAESILIPEIPFDLEEISEKLRRGFQRGKNHSIIMVAEGAGNVIDIARQLTDQ
SGFENRVTILGHVQRGGSPSSADAVLAGLMGAKAVEALLEGQSEVMIASSGNEIVTKSLD
IAFAPKPYSKEKIYQTADELAI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgggctgttgataaggttgccgtgttgacaagcggaggagatgctccggggatgaat
gcggcgataagagctgtcgtcaggaagggaatatttcataatctgaggatttttggcgta
taccatggttttgctggtttgatcaatggtcagatcacgcaaatggaacttggttctgta
gccgatattgtccatcgcgggggaacgatcctgaaaaccgccaggtgcaaggagatgctt
ttgcccgaagggcaaaagctggcggcagaccagcttattgccagaggaatagacgctttg
gtggcgattggcggagacggtacataccggggagcaaaaaaattagccgaattggggatc
aaggtcgtcgggattccgggtacgatcgataatgatattaatggaacagattttaccatc
ggattcgatacatctgtaaatactgtcgtcgaggccgtaagtaaattaagggatacggcc
acttctcatgaacgcgtctttgtggtggaggtaatgggcaggaactgtggggatatcgct
ctgcacgcggggttggccacgggtgctgaatcgattttaattcccgaaattccgtttgac
ctggaagaaatcagtgaaaaattgcgaagaggatttcaaagagggaagaaccacagcatt
attatggtggctgaaggagctggaaatgtgatcgatattgccagacagctcacagatcaa
tcaggatttgaaaacagggtgaccatcttaggacatgtgcagcggggcgggtctccttct
tcagcggatgccgtgctggcaggtcttatgggggccaaggccgtagaggccctgctggaa
ggacagtcggaagtgatgatcgcttcttcgggaaacgaaatcgtcaccaaaagcctggat
attgcctttgcgcccaaaccatactctaaagaaaagatttatcaaactgcagatgagctg
gcaatttag

DBGET integrated database retrieval system